[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30447.1
DDBJ      :             MutT/nudix family protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  125/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->71 1x72A PDBj 8e-04 34.4 %
:BLT:PDB   93->194 2jvbA PDBj 2e-08 24.2 %
:RPS:PDB   76->209 2dukA PDBj 6e-17 17.7 %
:RPS:SCOP  76->191 1sjyA  d.113.1.1 * 8e-18 21.2 %
:HMM:SCOP  75->208 2fmlA2 d.113.1.6 * 4.7e-28 31.3 %
:RPS:PFM   18->67 PF12535 * Nudix_N 6e-07 42.0 %
:RPS:PFM   79->191 PF00293 * NUDIX 1e-11 34.5 %
:HMM:PFM   81->193 PF00293 * NUDIX 7.1e-20 25.0 112/135  
:HMM:PFM   18->67 PF12535 * Nudix_N 1.6e-17 36.0 50/58  
:BLT:SWISS 34->205 YJHB_BACSU 3e-27 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30447.1 GT:GENE ACD30447.1 GT:PRODUCT MutT/nudix family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 466696..467343 GB:FROM 466696 GB:TO 467343 GB:DIRECTION + GB:PRODUCT MutT/nudix family protein GB:PROTEIN_ID ACD30447.1 GB:DB_XREF GI:187712150 LENGTH 215 SQ:AASEQ MWYILFYLLGKDKLMHKDKIFEFIKKVQAISHTGIVYSKCPYALDNYHELLELSSKMLHEYIKSDVQPYDIYRDMYYPTPQPGVRVVIFKDDKLMMTEDADTPNEWTIPGGWCDIDLSPVETCIKEVKEETGYDIKVVKFLALMDRNKYTQSEIYNVYSLVFLAQIIGGENNPNFEVKKVDFFEIDKLPKLSHKLTKTELNIILEAYKQDIIYFE GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 34->205|YJHB_BACSU|3e-27|32.7|171/208| BL:PDB:NREP 2 BL:PDB:REP 1->71|1x72A|8e-04|34.4|64/326| BL:PDB:REP 93->194|2jvbA|2e-08|24.2|99/146| RP:PDB:NREP 1 RP:PDB:REP 76->209|2dukA|6e-17|17.7|130/138| RP:PFM:NREP 2 RP:PFM:REP 18->67|PF12535|6e-07|42.0|50/58|Nudix_N| RP:PFM:REP 79->191|PF00293|1e-11|34.5|110/132|NUDIX| HM:PFM:NREP 2 HM:PFM:REP 81->193|PF00293|7.1e-20|25.0|112/135|NUDIX| HM:PFM:REP 18->67|PF12535|1.6e-17|36.0|50/58|Nudix_N| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 76->191|1sjyA|8e-18|21.2|113/154|d.113.1.1| HM:SCP:REP 75->208|2fmlA2|4.7e-28|31.3|134/0|d.113.1.6|1/1|Nudix| OP:NHOMO 158 OP:NHOMOORG 128 OP:PATTERN -------1---------------------------11------------------------------- -------------------------1---------------11----1---------------------------111---------------1-----------1-1-----------------------------------------------------------1-1-----------------------13333322213222321111-1233------1-------1--------------------11-1111-11322--11-1---11----------1111111111111-------------111---111------1111111-1--1---11------1--------------------1-1------------------1-------------------------------------------------------11111111-11--------------------------------------------------------------------------------------------------------------------11---------------------1------------------------------11-----------------------------------------------------------------1--------------------------------------------1-------------------------------1111-1------------1--------11-1-1-1---------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 100.0 SQ:SECSTR cEEEEcTTcccHHHHHHcccccccccTTTccEEEEEEcccEccGGGEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEEEccTTccEEEEEEccccTTcEEccEEEccTTccHHHHHHHHHHHHTcEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEccccTTHHHHcccEEEEEHHHHHHHHHTcTcHHHHHHHTTTccTccccc DISOP:02AL 215-216| PSIPRED ccEEEEEHHcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEcccccccccEEEEEEEEEEEEccccccccccHHEEEEEcHHHHHcccccccHHHHHHHHHHHHccccccc //