[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30465.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->52 PF10985 * DUF2805 1e-14 67.3 %
:HMM:PFM   1->54 PF10985 * DUF2805 9.3e-29 68.5 54/73  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30465.1 GT:GENE ACD30465.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 485438..485629 GB:FROM 485438 GB:TO 485629 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30465.1 GB:DB_XREF GI:187712168 LENGTH 63 SQ:AASEQ MAWCDKTSFDAIKEITGLSEPQVIKIMRNNLKPSSFKLWRKRVTGRVAKHQKRLNHINADSLV GT:EXON 1|1-63:0| RP:PFM:NREP 1 RP:PFM:REP 1->52|PF10985|1e-14|67.3|52/73|DUF2805| HM:PFM:NREP 1 HM:PFM:REP 1->54|PF10985|9.3e-29|68.5|54/73|DUF2805| OP:NHOMO 63 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------11--1-1--------------------------------------1---------1111111---11111--1111-11-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------1--------------------------------------11--------------------1-----------------------------------------------1-----------------------------11--1112------1---------------------------------------------------------------------------------------------------------------1-------------1---------------------111--------------------1111111-1-----311311-1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 62-64| PSIPRED ccccccccHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHcc //