[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30467.1
DDBJ      :             bile acid symporter family protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  149/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
:309 amino acids
:PSIPRED
:HMM:PFM   39->213 PF01758 * SBF 6.6e-27 28.6 175/187  
:HMM:PFM   11->59 PF04279 * IspA 5.8e-05 28.6 49/176  
:BLT:SWISS 26->294 YOCS_BACSU 2e-25 31.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30467.1 GT:GENE ACD30467.1 GT:PRODUCT bile acid symporter family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 488896..489825 GB:FROM 488896 GB:TO 489825 GB:DIRECTION + GB:PRODUCT bile acid symporter family protein GB:PROTEIN_ID ACD30467.1 GB:DB_XREF GI:187712170 LENGTH 309 SQ:AASEQ MMKMNFIQKYFAIIVIAGVILAISIPSIFIPLKPYITYLLAAIMLIIGLHLQAKDFVKVANLKGKLLVILFLKLTVTSIAAFIIGKLFGLSLTALIGLVIVGACPGGTASGVMALLARANISLVVSLTFLTTLLAPIFMPLIIYFFFSKSIKLDWFGMFETMAIIVIVPIVLGILISKFTKLNDSTLKKISNIPILLIMLIVMVVTALNKDTMMLVPTDIILSVIILSIFANIFGYLIGRVLGLDIDSRLALLFEFSILNVGLGIVIALAFFGNQAAIAATFYAIWQNIIGPIIVNLVNICRNTKFKSS GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 26->294|YOCS_BACSU|2e-25|31.3|265/321| TM:NTM 8 TM:REGION 19->41| TM:REGION 65->87| TM:REGION 93->115| TM:REGION 125->147| TM:REGION 159->181| TM:REGION 190->212| TM:REGION 218->240| TM:REGION 255->277| SEG 12->25|aiiviagvilaisi| SEG 122->134|slvvsltflttll| SEG 164->176|iivivpivlgili| SEG 195->205|illimlivmvv| HM:PFM:NREP 2 HM:PFM:REP 39->213|PF01758|6.6e-27|28.6|175/187|SBF| HM:PFM:REP 11->59|PF04279|5.8e-05|28.6|49/176|IspA| OP:NHOMO 175 OP:NHOMOORG 167 OP:PATTERN ----------------------------1---------11111-------1-1--------------- -----111111--1------------------------------1-------111----------1---------1-1--1--------------------------------------------1----1--------------------------------------------------------------111111-11-111-111111-1-1-1-1-1-----------111-1111111111----1---------------------1-----------------------------------------11------------------------1-------------------------------------------------------11-11111111--------------11---------------------------------111----------------------------------------11--------1------1---------1-------------------------------11111--------------1-1-----------------------1------------------1---------1-------1111---1--1-1--1-----1---------11----1------------------------------111-------------111-1--11----------------------------------11-111111-1---------1111111-----1111----1-1---1111111111111-------------------------------122--11-----------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---71111----1-1-1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccc //