[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30469.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   139->231 1e2tA PDBj 2e-04 11.2 %
:RPS:SCOP  119->198 1gx3A  d.3.1.5 * 9e-06 12.7 %
:HMM:SCOP  140->223 1x3zA1 d.3.1.4 * 6e-07 25.4 %
:HMM:PFM   140->197 PF01841 * Transglut_core 1.7e-05 19.3 57/113  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30469.1 GT:GENE ACD30469.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 491814..492800 GB:FROM 491814 GB:TO 492800 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30469.1 GB:DB_XREF GI:187712172 LENGTH 328 SQ:AASEQ MRLLITTLSLIPSIILAAPQLYNSKDKFINEEIKKHYLKFSTFTYPGLYQDKLKNDLPDDIREIGLLVRKNFIHRTTLAAGNTGTNADLKFGNMQKVPWWRQPEDDILVTAGAMLTELYRRNNSGFVEDREPKDKLVLTCRFVSIMVANILKSKGIPARVSAGHAAYFDMSELGNVSTDHWINQYWNEQENRWITIDVNGSFSLNENFDPYDMPERKFDFPADAWLGIRAGKLDPQHFYNAKSERGAIVVLWSLFYDFHALMNNEIIYTYGPAGGYGGYDKFNSLTKDEFEKIDNLARLMQNPDENFDELVKIWETEKDFRLLMGGLL GT:EXON 1|1-328:0| SEG 3->19|llittlslipsiilaap| SEG 76->87|ttlaagntgtna| SEG 268->279|ytygpaggyggy| RP:PDB:NREP 1 RP:PDB:REP 139->231|1e2tA|2e-04|11.2|89/274| HM:PFM:NREP 1 HM:PFM:REP 140->197|PF01841|1.7e-05|19.3|57/113|Transglut_core| RP:SCP:NREP 1 RP:SCP:REP 119->198|1gx3A|9e-06|12.7|79/276|d.3.1.5| HM:SCP:REP 140->223|1x3zA1|6e-07|25.4|71/0|d.3.1.4|1/1|Cysteine proteinases| OP:NHOMO 21 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1----------------------1------------------------------------------------------------------------------11------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------21-----------------------------------------------1--------------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------------------------------------------------111-1-----1--------11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 27.1 SQ:SECSTR ##########################################################################################################################################cHHHHHHHHHHHHHHTTccEEEEEEE##EcTTcccccccccEEEEEEEE##TTEEEEEcccccTTcccccEEccccccEEETTEEEEEEccTT################################################################################################# DISOP:02AL 328-329| PSIPRED cEEEHHHHHHHHHHHHHcHHHHcccHHccccHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEHHHHHHHHHHHHHHccccHHHEEEEEEEEccccccccccHHHHHHHHHccccEEEEEEccccEEEEEccccccccHHHHccHHHHHHHHHcccccHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHccc //