[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30471.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->106 PF04241 * DUF423 7e-08 33.0 %
:HMM:PFM   15->107 PF04241 * DUF423 2.6e-23 36.0 89/89  
:BLT:SWISS 3->107 Y1073_HAEIN 9e-09 34.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30471.1 GT:GENE ACD30471.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(494188..494610) GB:FROM 494188 GB:TO 494610 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30471.1 GB:DB_XREF GI:187712174 LENGTH 140 SQ:AASEQ MNLIIGAILGFISVAFGAYAEHGLKSQISAEHFNFIMTALRYNQIYAIIISGIGLALISSKHVAQSLMLKLSSSLFIIGTVLFSFSIYISIICNIQSLMKIAPIGGTILMLAWISLAIAAISLKKRLSNNFIDNHAKNIQ GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 3->107|Y1073_HAEIN|9e-09|34.0|100/124| TM:NTM 4 TM:REGION 1->23| TM:REGION 43->65| TM:REGION 71->93| TM:REGION 102->123| SEG 47->60|aiiisgiglaliss| SEG 108->123|ilmlawislaiaaisl| RP:PFM:NREP 1 RP:PFM:REP 15->106|PF04241|7e-08|33.0|88/90|DUF423| HM:PFM:NREP 1 HM:PFM:REP 15->107|PF04241|2.6e-23|36.0|89/89|DUF423| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 134-135| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //