[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30475.1
DDBJ      :             ribonuclease PH
Swiss-Prot:RNPH_FRATM   RecName: Full=Ribonuclease PH;         Short=RNase PH;         EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase;

Homologs  Archaea  27/68 : Bacteria  598/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.101.1d.14.1
:235 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->231 1r6mA PDBj 2e-82 67.1 %
:RPS:PDB   2->232 3b4tB PDBj 3e-64 57.0 %
:RPS:SCOP  1->150 1oypA1  d.14.1.4 * 4e-38 63.2 %
:RPS:SCOP  154->232 1e3hA6  d.101.1.1 * 2e-20 15.4 %
:HMM:SCOP  1->140 1oysA1 d.14.1.4 * 5.2e-43 39.3 %
:HMM:SCOP  154->234 1oysA2 d.101.1.1 * 2.7e-22 44.4 %
:RPS:PFM   10->140 PF01138 * RNase_PH 1e-18 42.5 %
:RPS:PFM   161->225 PF03725 * RNase_PH_C 2e-05 36.9 %
:HMM:PFM   10->140 PF01138 * RNase_PH 2e-30 36.2 127/132  
:HMM:PFM   161->226 PF03725 * RNase_PH_C 2.1e-16 25.8 66/68  
:BLT:SWISS 1->235 RNPH_FRATM e-132 100.0 %
:PROS 116->128|PS01277|RIBONUCLEASE_PH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30475.1 GT:GENE ACD30475.1 GT:PRODUCT ribonuclease PH GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 496465..497172 GB:FROM 496465 GB:TO 497172 GB:DIRECTION + GB:PRODUCT ribonuclease PH GB:PROTEIN_ID ACD30475.1 GB:DB_XREF GI:187712178 LENGTH 235 SQ:AASEQ MRPSGRNNDQLRNLKVTHNFTKHAEGSVLIEFGDTKVICTASVVAGVPKFKKDSGEGWLTAEYGMLPRSTHMRMDREAARGKQSGRTQEIQRLIGRALRASVDLTAIGENTIKIDCDVIQADGGTRTASITGASLAIADAIEYMKQNGMLDEQANPLLSQVAAISVGIYNNEPVLDLDYDEDSNAETDMNVVMNSNGGIIEIQGTAEGKDFSEEEFAKMLGLAKKGIKEIFATVF GT:EXON 1|1-235:0| SW:ID RNPH_FRATM SW:DE RecName: Full=Ribonuclease PH; Short=RNase PH; EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase; SW:GN Name=rph; OrderedLocusNames=FTM_0450; SW:KW Complete proteome; Nucleotidyltransferase; Transferase;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|RNPH_FRATM|e-132|100.0|235/235| GO:SWS:NREP 3 GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 116->128|PS01277|RIBONUCLEASE_PH|PDOC00983| BL:PDB:NREP 1 BL:PDB:REP 2->231|1r6mA|2e-82|67.1|225/236| RP:PDB:NREP 1 RP:PDB:REP 2->232|3b4tB|3e-64|57.0|223/239| RP:PFM:NREP 2 RP:PFM:REP 10->140|PF01138|1e-18|42.5|127/130|RNase_PH| RP:PFM:REP 161->225|PF03725|2e-05|36.9|65/68|RNase_PH_C| HM:PFM:NREP 2 HM:PFM:REP 10->140|PF01138|2e-30|36.2|127/132|RNase_PH| HM:PFM:REP 161->226|PF03725|2.1e-16|25.8|66/68|RNase_PH_C| GO:PFM:NREP 6 GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF01138|IPR001247| GO:PFM GO:0003723|"GO:RNA binding"|PF01138|IPR001247| GO:PFM GO:0006396|"GO:RNA processing"|PF01138|IPR001247| GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF03725|IPR015847| GO:PFM GO:0003723|"GO:RNA binding"|PF03725|IPR015847| GO:PFM GO:0006396|"GO:RNA processing"|PF03725|IPR015847| RP:SCP:NREP 2 RP:SCP:REP 1->150|1oypA1|4e-38|63.2|133/134|d.14.1.4| RP:SCP:REP 154->232|1e3hA6|2e-20|15.4|78/96|d.101.1.1| HM:SCP:REP 1->140|1oysA1|5.2e-43|39.3|140/151|d.14.1.4|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 154->234|1oysA2|2.7e-22|44.4|81/86|d.101.1.1|1/1|Ribonuclease PH domain 2-like| OP:NHOMO 666 OP:NHOMOORG 658 OP:PATTERN ------11-------111-----1--------111-------------1211211111121211-1-1 1111111111111111111-1111111111111111111111111111-1111111111111111111111-1111111--1-11111------------------------------------------------11111111-11111---111111111-1-1-1111-1-----1----111--11--11111111111111111111111111111111111111111--------------------1---------------------------------------------------------------------111---------1-11111-111--1--1--1111111111111111-111111111-----111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------111111111111111-----11111111111111111111111111111111111111-111111111--111-11111111111111111111111---1----------1111111111111111--------------------------11111111111111111111111111111111--11111------11111111111-11111-11-1111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111--1------------------------------------------------------11 ----111-------1-----------------------------------------------1----1---1---11111------1----------------11--1-12---------------------------------------------------1-211--21111-----------1--1-11-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 98.7 SQ:SECSTR ccTTcccTTccccEEEEETccccccEEEEEEETTEEEEEEEEEEEccccccccccccEEEEEEEEcTTccccccccHHHHTcccHHHHHHHHHHHHHHHTTccTTTTccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHTTccccEcccccccEEEEEEEEETTEEEEcccHHHHTTccEEEEEEEETTccEEEEEcccTTccccHHHHHHHHHHHHHHHHHHHH### PSIPRED cccccccHHHEEEEEEEEcccccccEEEEEEEcccEEEEEEEEcccccHHHccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccEEEEEccHHHHHHccccEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHc //