[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30478.1
DDBJ      :             LemA-like protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  445/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.9
:191 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->149 2etdA1  a.29.9.1 * 3e-20 32.0 %
:HMM:SCOP  25->178 2etdA1 a.29.9.1 * 1.1e-36 37.6 %
:RPS:PFM   22->164 PF04011 * LemA 2e-25 43.4 %
:HMM:PFM   2->184 PF04011 * LemA 7.9e-43 31.5 181/186  
:BLT:SWISS 30->172 Y1576_METJA 5e-15 31.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30478.1 GT:GENE ACD30478.1 GT:PRODUCT LemA-like protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(499743..500318) GB:FROM 499743 GB:TO 500318 GB:DIRECTION - GB:PRODUCT LemA-like protein GB:PROTEIN_ID ACD30478.1 GB:DB_XREF GI:187712181 LENGTH 191 SQ:AASEQ MSIGIILLIIVVVIAVYVVMTYNKLIAEIETVKNSEKQIDVQLDRRAKVFDSLVNVVKKYMDYEQTTLKQVVALRNQANLAKENGDIQERINAENKISDLAKGINVQFENYPELKANQNVIQLQEEITSTENKLAFAKQALNDSIERYNAHKKSFFAGIVVSIFKKLNEDFVYWNISEEKKQQLEDSRVEL GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 30->172|Y1576_METJA|5e-15|31.4|140/189| TM:NTM 1 TM:REGION 1->23| SEG 3->19|igiilliivvviavyvv| RP:PFM:NREP 1 RP:PFM:REP 22->164|PF04011|2e-25|43.4|143/184|LemA| HM:PFM:NREP 1 HM:PFM:REP 2->184|PF04011|7.9e-43|31.5|181/186|LemA| RP:SCP:NREP 1 RP:SCP:REP 25->149|2etdA1|3e-20|32.0|122/139|a.29.9.1| HM:SCP:REP 25->178|2etdA1|1.1e-36|37.6|149/0|a.29.9.1|1/1|LemA-like| OP:NHOMO 519 OP:NHOMOORG 450 OP:PATTERN --------------------------------21--1-------------1-1--------------- 111--------1--1------1---1------1111---------1-1---1------11--1--------1111111111-1-----2241-111---114211-2111--------------111111111--1-----222----11-------------------1--1-----1---------112------------------1-------------11111111--1--------------1----11111111111111111111111---11111111111111111111111111111111111-1111111111--11111111-1---11-----1-21-----11---1--1-22121111--1112111111-211112-111211111111111-1111111111--111-1111111111111--------------------------------------------------------2-2-1111111------1111---111111112-1111--2211113113211-221122-1--------2111211-11--11-2-----21221112-2222-11-121-1-----------------1-1--111-11-1---1-111--2111-1122-11--211-1----------------1--11-------1-11---11-----1-----1-2---------------------------11111111111---11111111111211-1111111-------12222211121112212-2111----2---111111111-----------1-111111111111----11------11--------111------111111----1----111112-1111111-2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 190-192| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccHHcccccc //