[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30480.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->92 3f6vA PDBj 2e-08 29.9 %
:RPS:PDB   1->117 2cweA PDBj 2e-09 16.2 %
:RPS:SCOP  2->80 1fnnA1  a.4.5.11 * 1e-12 13.9 %
:HMM:SCOP  1->80 1u2wA1 a.4.5.5 * 1.4e-18 33.8 %
:RPS:PFM   15->59 PF01022 * HTH_5 3e-07 42.2 %
:HMM:PFM   15->61 PF01022 * HTH_5 8.9e-14 42.6 47/47  
:BLT:SWISS 11->80 CADF_STAAU 2e-09 35.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30480.1 GT:GENE ACD30480.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(503853..504218) GB:FROM 503853 GB:TO 504218 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID ACD30480.1 GB:DB_XREF GI:187712183 LENGTH 121 SQ:AASEQ MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYFYFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKENIL GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 11->80|CADF_STAAU|2e-09|35.7|70/121| BL:PDB:NREP 1 BL:PDB:REP 6->92|3f6vA|2e-08|29.9|87/96| RP:PDB:NREP 1 RP:PDB:REP 1->117|2cweA|2e-09|16.2|117/191| RP:PFM:NREP 1 RP:PFM:REP 15->59|PF01022|3e-07|42.2|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 15->61|PF01022|8.9e-14|42.6|47/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 2->80|1fnnA1|1e-12|13.9|79/103|a.4.5.11| HM:SCP:REP 1->80|1u2wA1|1.4e-18|33.8|80/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 42 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------1---1------------------------------------------------------------------------------------1----------------------------1---------------------------------------------------------------------------2---------------11------1-1-11--33---1----1-1---1-------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------1------------1--------------------1---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------111111111-------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 97.5 SQ:SECSTR EEEEccHHHHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEEETTEEEEcccEEEEcTTcccHHHHHHHHHHHHHHHHHHHHTTccccHHHHHH### DISOP:02AL 120-122| PSIPRED ccHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEcHHHHHHHHHHHHHHHccHHccccHHHHHHHHHcHHHHHHHHHHHHHcc //