[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30482.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->151 PF02674 * Colicin_V 1e-18 22.7 141/146  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30482.1 GT:GENE ACD30482.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(506333..506869) GB:FROM 506333 GB:TO 506869 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30482.1 GB:DB_XREF GI:187712185 LENGTH 178 SQ:AASEQ MEFLSSLNFLDILIMIVILILSLFAAVKGLFKNIVLLLLMVFAVVLSGILAQKIQQIYVGSLIEDPGTAYVVSFILVLLCAYLIIFGIMKVFLRNNKEKESLSNTLFAFFIALVRFSFIFAIACSTLNSIDAVKDNSLWQNSTLVQPLVKVGDYAFNTKVKMQQTNLKDYVPKQVAGG GT:EXON 1|1-178:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 32->54| TM:REGION 70->92| TM:REGION 106->128| SEG 10->23|ldilimivililsl| SEG 35->46|vllllmvfavvl| HM:PFM:NREP 1 HM:PFM:REP 10->151|PF02674|1e-18|22.7|141/146|Colicin_V| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-32,34-34,39-39,143-143,146-146| PSIPRED cHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHcccHHHHHHHHHHHHHHHHccc //