[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30505.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y486_FRATM   RecName: Full=UPF0102 protein FTM_0486;

Homologs  Archaea  0/68 : Bacteria  313/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->102 3fovA PDBj 1e-07 37.3 %
:RPS:SCOP  8->113 2inbA1  c.52.1.32 * 2e-17 12.4 %
:HMM:SCOP  8->112 1hh1A_ c.52.1.18 * 2.1e-20 37.4 %
:RPS:PFM   14->102 PF02021 * UPF0102 4e-17 46.0 %
:HMM:PFM   10->102 PF02021 * UPF0102 3.7e-28 38.5 91/93  
:BLT:SWISS 1->117 Y486_FRATM 8e-65 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30505.1 GT:GENE ACD30505.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(531806..532159) GB:FROM 531806 GB:TO 532159 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30505.1 GB:DB_XREF GI:187712208 LENGTH 117 SQ:AASEQ MQTIEIGNKAELQACKFLHTQALEILAHNFKALPYGEIDIIALDKDTLVFIEVKYRSKTKFAQAEEMLTYSKQQKLVNSASIYLQHNPQYQDYQCRFDLIAINESNINWIKNAFGVI GT:EXON 1|1-117:0| SW:ID Y486_FRATM SW:DE RecName: Full=UPF0102 protein FTM_0486; SW:GN OrderedLocusNames=FTM_0486; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|Y486_FRATM|8e-65|100.0|117/117| BL:PDB:NREP 1 BL:PDB:REP 10->102|3fovA|1e-07|37.3|83/101| RP:PFM:NREP 1 RP:PFM:REP 14->102|PF02021|4e-17|46.0|87/93|UPF0102| HM:PFM:NREP 1 HM:PFM:REP 10->102|PF02021|3.7e-28|38.5|91/93|UPF0102| RP:SCP:NREP 1 RP:SCP:REP 8->113|2inbA1|2e-17|12.4|105/128|c.52.1.32| HM:SCP:REP 8->112|1hh1A_|2.1e-20|37.4|99/0|c.52.1.18|1/1|Restriction endonuclease-like| OP:NHOMO 315 OP:NHOMOORG 313 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11-----------------------------------------1---11-------------------1--1-----------------11-11--1------111---1-111-11--------1-1----1-----------------111------------------------------------------------------------------------------------------------------------------------------------1-1--1111111-1-11------1-111-11-111-1-111--1111-11-1------------1--111----1--------------------1-------------------------------------------------1-----------------------------------------------1111--------1------111-1---------11--1111-1111111211--1-1-11-11------1-1--1--1-------12-1---11111---------------11111111111111111111111111111111---1--1------111111-1111111111-111111111111111111111111111111111111111111111111111--111111111111--1111111-111-11111111111111111111111111111111111111-1111111111111111-11111-111111111111-----1111111--1---------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 70.9 SQ:SECSTR #########HHHHHHHHHHHTTcEEEEEEEEET#TEEEEEEEEETTEEEEEEEEEcccc########ccHHHHHHHHHHHHHHHHHcGGGTc#EEEEEEEEE############### DISOP:02AL 117-118| PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEEccEEEEEEEEEEcccccccHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEcHHHHcc //