[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30507.1
DDBJ      :             13 kDa major membrane protein
Swiss-Prot:MP13_FRATH   RecName: Full=13 kDa major membrane protein;

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.103.1
:123 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->123 2gm2A PDBj 3e-12 31.8 %
:RPS:PDB   11->123 3cpkA PDBj 3e-17 22.7 %
:RPS:SCOP  14->123 2fi9A1  c.103.1.1 * 1e-21 22.9 %
:HMM:SCOP  2->125 2fvtA1 c.103.1.1 * 1.1e-22 30.3 %
:RPS:PFM   18->123 PF04430 * DUF498 3e-09 32.4 %
:HMM:PFM   16->123 PF04430 * DUF498 2.7e-28 29.9 107/110  
:BLT:SWISS 1->123 MP13_FRATH 6e-67 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30507.1 GT:GENE ACD30507.1 GT:PRODUCT 13 kDa major membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 534339..534710 GB:FROM 534339 GB:TO 534710 GB:DIRECTION + GB:PRODUCT 13 kDa major membrane protein GB:PROTEIN_ID ACD30507.1 GB:DB_XREF GI:187712210 LENGTH 123 SQ:AASEQ MMTLQEEKIQAPVFFKEYVKGRFILNIGEYNHPLILSATQVLEYQDKIDDIQSIKKSHLDLILATNPEIILIGTGEKQLLPPLEIINQIAKAGKSVDFMASDTACKTYNLLVNENRNVSCIII GT:EXON 1|1-123:0| SW:ID MP13_FRATH SW:DE RecName: Full=13 kDa major membrane protein; SW:GN OrderedLocusNames=FTL_0420; SW:KW Cell membrane; Complete proteome; Membrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->123|MP13_FRATH|6e-67|100.0|123/123| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| BL:PDB:NREP 1 BL:PDB:REP 35->123|2gm2A|3e-12|31.8|88/132| RP:PDB:NREP 1 RP:PDB:REP 11->123|3cpkA|3e-17|22.7|110/115| RP:PFM:NREP 1 RP:PFM:REP 18->123|PF04430|3e-09|32.4|105/110|DUF498| HM:PFM:NREP 1 HM:PFM:REP 16->123|PF04430|2.7e-28|29.9|107/110|DUF498| RP:SCP:NREP 1 RP:SCP:REP 14->123|2fi9A1|1e-21|22.9|109/118|c.103.1.1| HM:SCP:REP 2->125|2fvtA1|1.1e-22|30.3|122/0|c.103.1.1|1/1|MTH938-like| OP:NHOMO 32 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------11---------------------11-------211------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------1111-------------------------------------------------1111111111----------------11111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 91.9 SQ:SECSTR ##########ccccEEEEETTEEEETTEEEcccEEEccccccEEcccccGGGccHHHHHHHHTcccccEEEEEcTccccccHHHHHHHHTTcEEEEcHHHHHHHHHHHHHHHTTccEEEEEcc PSIPRED cccccccccccccEEEEEcccEEEEccEEEEccEEEEcccccccccccccHHHHcHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccEEEEEEc //