[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30510.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:HMM:PFM   1->19 PF08139 * LPAM_1 1.7e-05 52.6 19/26  
:HMM:PFM   72->112 PF02014 * Reeler 0.00042 27.5 40/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30510.1 GT:GENE ACD30510.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 536507..536974 GB:FROM 536507 GB:TO 536974 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30510.1 GB:DB_XREF GI:187712213 LENGTH 155 SQ:AASEQ MKKILIFTLMTATLAGCSKYNAFIDKLYDSDNSIKVNPDDNLDNPDQDGEVVSEDKPTATLKLKYKATTHEIDARIITNWNGAPQGTIYLTWVAPKDTNCYSTSFPITKFNETQDYTVDSQSVLSDDKVCNGTWTALIVNKSDNLELAKASLEIK GT:EXON 1|1-155:0| SEG 37->48|npddnldnpdqd| SEG 56->69|kptatlklkykatt| HM:PFM:NREP 2 HM:PFM:REP 1->19|PF08139|1.7e-05|52.6|19/26|LPAM_1| HM:PFM:REP 72->112|PF02014|0.00042|27.5|40/132|Reeler| OP:NHOMO 18 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222222222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEccccccccccccccEEEccccccEEEEEEEEccccEEccEEEEEEEccccccHHHHccEEcc //