[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30516.1
DDBJ      :             lipolytic enzyme
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.23.10
:293 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   6->156 3dciA PDBj 3e-09 20.6 %
:RPS:PDB   139->290 3c1uA PDBj 2e-10 10.5 %
:RPS:SCOP  4->175 1yzfA1  c.23.10.5 * 9e-05 19.8 %
:RPS:SCOP  192->290 1deoA  c.23.10.4 * 1e-07 13.1 %
:HMM:SCOP  5->289 1deoA_ c.23.10.4 * 3e-12 25.6 %
:HMM:PFM   7->284 PF00657 * Lipase_GDSL 4.7e-20 24.9 221/235  
:BLT:SWISS 3->287 HLT_VIBPA 4e-22 32.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30516.1 GT:GENE ACD30516.1 GT:PRODUCT lipolytic enzyme GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 543308..544189 GB:FROM 543308 GB:TO 544189 GB:DIRECTION + GB:PRODUCT lipolytic enzyme GB:PROTEIN_ID ACD30516.1 GB:DB_XREF GI:187712219 LENGTH 293 SQ:AASEQ MRQINRLVVFGDSLLDNGNIMKTLDIPGKPYHDGRFSNGLVSTEVLAQMLAKDQKLSEIKHKNYAIGGALTHGTNPSSLLRFHSFSVSEQIIRFENEEGRFADDDLVVINGGANNFMFMVYNEIPYINLVPKFRVARDLNKIVRKTIKMGAKNIILWNIPDVTKAPAYKDYLSNWVGKFFKSYMQINVNLQNGLLRNRVSELQAIFPHINLKLFDFYSLLNDCVENPAKYGFENVTDACIDSYGGADSLGNIQYDIEIMGDPEKYLCWDYCHPTAKANRLVASKMFDLWKLDI GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 3->287|HLT_VIBPA|4e-22|32.2|258/418| RP:PDB:NREP 2 RP:PDB:REP 6->156|3dciA|3e-09|20.6|126/203| RP:PDB:REP 139->290|3c1uA|2e-10|10.5|152/231| HM:PFM:NREP 1 HM:PFM:REP 7->284|PF00657|4.7e-20|24.9|221/235|Lipase_GDSL| RP:SCP:NREP 2 RP:SCP:REP 4->175|1yzfA1|9e-05|19.8|131/195|c.23.10.5| RP:SCP:REP 192->290|1deoA|1e-07|13.1|99/233|c.23.10.4| HM:SCP:REP 5->289|1deoA_|3e-12|25.6|195/233|c.23.10.4|1/1|SGNH hydrolase| OP:NHOMO 142 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------11111--------------11151--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1---------------------1---------------------------1---------------------------------------------------------------------------1----------------1---------11--1-1---------------------------------------------------------11------1-1-1---1-------------------------------------------------------------------------------------------------1--------------------2222--------------------------------------1----------111111111-----1111111111------------------------------------------------------------------------- --------------2-------------------------------------1--------------------------------------------------3---------------------------------------------------------------------------------7CFA-KD------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 93.2 SQ:SECSTR #####EEEEEEcHHHHTcc##########TTTcccccGGGcHHHHHHHHHTTcHHHTcEEEEEEEcTTcccccccc##cccccccccHHHHHHHHHHHHHHHHcccEEEEccTTTTcGTcGGTccHHHHHHHHHHHHHTHHHHHHHHccTTcEEEEcccTTcccccccccccccccccccEEEEETTEEEEHHHHHHHHHHHHHTTcEEEEEccccccTTTTccccccccHHHHHHHHHHHHHTcEHHHHHHHHHHHcHHHHHHTcccccccccHHHHHHHHHHHHHHHH### PSIPRED cccccEEEEEccccEEcccccccccccccccccccccccccHHHHHHHHccccccccccccccEEEEEEEccccccccEEccccccHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHcHHHccccccccccccccccccccccccccccccccHHHcEEcccccHHHHHHHHHHHHHHHHccccc //