[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30518.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:HMM:PFM   1->19 PF08139 * LPAM_1 0.00051 57.9 19/26  
:HMM:PFM   41->88 PF04878 * Baculo_p48 0.00048 27.1 48/375  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30518.1 GT:GENE ACD30518.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 545613..546080 GB:FROM 545613 GB:TO 546080 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30518.1 GB:DB_XREF GI:187712221 LENGTH 155 SQ:AASEQ MSKKIFTLCLASLALASCTVKSDIEDNITHYEKLTRYSMIKQLDFSKHTNDIDGARFLVANYPDQVIRLNGTDFDNKYDKLVSYLKTNGYTIMVNEKLPLTATIIAEINKPLPDVKYIGIIMQQDSRMDQTIYNISYGGNEFKARQFYTDYKKTL GT:EXON 1|1-155:0| TM:NTM 1 TM:REGION 5->26| SEG 8->18|lclaslalasc| HM:PFM:NREP 2 HM:PFM:REP 1->19|PF08139|0.00051|57.9|19/26|LPAM_1| HM:PFM:REP 41->88|PF04878|0.00048|27.1|48/375|Baculo_p48| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccHHHcccccccEEEEEEccccEEEEEccccccHHHHHHHHHHHHccEEEEEccccccHHHHHHHHcccccccEEEEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHcc //