[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30525.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->56 PF11614 * Bre5 1.8e-05 20.8 48/120  
:BLT:SWISS 84->168 K0090_HUMAN 6e-04 24.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30525.1 GT:GENE ACD30525.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 557523..558041 GB:FROM 557523 GB:TO 558041 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30525.1 GB:DB_XREF GI:187712228 LENGTH 172 SQ:AASEQ MYATQVSAQLKIQNNSNAMMHVEMSKELSSKATFEGNTVYDIQPGKVQKVIVLIDYGATGDVQVKVDAQCKFNASIGAGVWELISSGGKHLANFKTEVGCNFAANASAFATLGISQLTSLVANVSFTKSDGLHECSLSEGYINIYPRSSNQVGIDYHIPDTLGGGLVWMPNK GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 84->168|K0090_HUMAN|6e-04|24.7|85/993| HM:PFM:NREP 1 HM:PFM:REP 9->56|PF11614|1.8e-05|20.8|48/120|Bre5| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 172-173| PSIPRED cccEEEEEEEEEEccccEEEEEEEccccccccEEcccEEEEEccccEEEEEEEEEcccccEEEEEEEEEEEEcccHHHHHHHHHHccccEEccccHHcccccccccHHHHcccHHHHHHHHHccEEEcccccEEEEccccEEEEEEcccccEEEEEEccccccccEEEEccc //