[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30538.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  590/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.11
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->132 2cveA PDBj 2e-19 45.1 %
:RPS:PDB   6->186 2cveA PDBj 5e-46 34.1 %
:RPS:SCOP  1->128 1vi7A1  d.14.1.11 * 1e-40 34.6 %
:RPS:SCOP  134->186 2cveA2  d.58.11.2 * 1e-04 9.4 %
:HMM:SCOP  4->131 2cveA1 d.14.1.11 * 3e-37 46.3 %
:HMM:SCOP  133->201 1vi7A2 d.58.11.2 * 1.7e-06 20.3 %
:RPS:PFM   18->123 PF01205 * UPF0029 4e-25 48.1 %
:HMM:PFM   18->123 PF01205 * UPF0029 6.4e-39 49.1 106/110  
:HMM:PFM   139->194 PF09186 * DUF1949 1.3e-09 26.8 56/56  
:BLT:SWISS 1->185 YVYE_BACSU 2e-26 34.8 %
:PROS 78->107|PS00910|UPF0029
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30538.1 GT:GENE ACD30538.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 570722..571324 GB:FROM 570722 GB:TO 571324 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30538.1 GB:DB_XREF GI:187712241 LENGTH 200 SQ:AASEQ MNGYKTISENIEFEIAPIKKSRFIVFIYKVANHIEVLNSLDAIKNSYPNANHYCWAYSLADNNQFRFNDDGEPGGSAGKPILSHIQGFEVTNVLVVVVRYFGGTKLGVGGLIRAYGQAAKEGLTLAKITCVEVQNEISLEYDYSETVNVENLANRYGIQIIKENYSDNISKIIKIVASDKDMFLEEIKNITKGKIKITVH GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|YVYE_BACSU|2e-26|34.8|184/217| PROS 78->107|PS00910|UPF0029|PDOC00707| SEG 187->198|iknitkgkikit| BL:PDB:NREP 1 BL:PDB:REP 6->132|2cveA|2e-19|45.1|122/190| RP:PDB:NREP 1 RP:PDB:REP 6->186|2cveA|5e-46|34.1|176/190| RP:PFM:NREP 1 RP:PFM:REP 18->123|PF01205|4e-25|48.1|106/110|UPF0029| HM:PFM:NREP 2 HM:PFM:REP 18->123|PF01205|6.4e-39|49.1|106/110|UPF0029| HM:PFM:REP 139->194|PF09186|1.3e-09|26.8|56/56|DUF1949| RP:SCP:NREP 2 RP:SCP:REP 1->128|1vi7A1|1e-40|34.6|127/135|d.14.1.11| RP:SCP:REP 134->186|2cveA2|1e-04|9.4|53/67|d.58.11.2| HM:SCP:REP 4->131|2cveA1|3e-37|46.3|123/0|d.14.1.11|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 133->201|1vi7A2|1.7e-06|20.3|69/0|d.58.11.2|1/1|EF-G C-terminal domain-like| OP:NHOMO 643 OP:NHOMOORG 630 OP:PATTERN ---------------------------112111----111111------111------111------- -----111111111-----------1-----------111------111--1111111----11-11111111111111111------1111-111---11111111111--------------------------111-----1--------------------------------------1111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11-1--111111111111------------------------11111111111--------------111--1---11---------------11111111-111---------------------------------------111111111111111-11111111-11111111--111-11211---1111--1111--111111-----1--1-11-11-11111-------1-----1---111111111211-1111111-11-1--111111111111111111111111111111--1-1--------11111111111111111-1111111111111111111111111111111111111111111111111111---1111111111---1---------111111111-1-111111111111111111--111111111111111111111111111111111111111111111111111--------------111111111-1----1-11111--111-1--1-1111111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11171111-1111-231121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 90.5 SQ:SECSTR #####EEcccEEEEEEEETTEEEEEEEEEcccHHHHHHHHHHHcHccTTccEEEEEEEETcTTEEEEEcTTccTTccHHHHHHHHHHTTcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccEEEcccEEEEEEEEcGGGHHHHHHHHHHTTccEEEEEETTEEEEEEEEEHHHHHHHHHH############## DISOP:02AL 200-201| PSIPRED ccccEEEEccEEEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEccccccccccHHHHHHHHHHcccccEEEEEEcccccEEccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEEHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHccEEEEEEc //