[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30545.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:326 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   246->302 PF12114 * Period_C 0.00063 27.3 55/195  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30545.1 GT:GENE ACD30545.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 587739..588719 GB:FROM 587739 GB:TO 588719 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30545.1 GB:DB_XREF GI:187712248 LENGTH 326 SQ:AASEQ MRNTIKIVILLSLGMLLQNCATSDVENDFSYENLTDTISGSPFRNRKYDYARVKVSEEPALKIPTGLNGEKIKPALKLPDGDNNYARSQVNEAQKQMLPPNYADKFDMEKIISDQISKVSISVVYDDTGSLKLVFREPLSITINLLDNYFKEHPDSYVITTEKDEILSGHLITVKDTKKDLIFVILARKVDELSSLVKVNVVFTSDGKTLAPNHIDEGVRILSDIRKDLNNTELKNDNNIEIAKQAEANLAASEANPKNGKSSLGGLLGSKKSSFGFGSYDRKIDNSLEQQKTNTNQEQQQDYTQMTAPADDKVYDSQAQPQVLNT GT:EXON 1|1-326:0| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 222->255| SEG 260->279|gksslggllgskkssfgfgs| SEG 289->301|eqqktntnqeqqq| HM:PFM:NREP 1 HM:PFM:REP 246->302|PF12114|0.00063|27.3|55/195|Period_C| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 326-327| PSIPRED cccEEEEHHHHHHHHHHHHcccccccccccHHHHHHcccccccccccccEEEEEEcccccccccccccHHHccccEEcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEEccEEHHHHHHHHHHHHccccEEEEEccccEEcccEEEEEcccccEEEEEEEHHHHHHHHEEEEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccccccEEEHHHHccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccc //