[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30551.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1a.7.7
:109 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   25->77 2q9lD PDBj 3e-05 41.5 %
:RPS:PDB   1->90 2a3qA PDBj 2e-06 25.0 %
:RPS:SCOP  19->92 1ugoA  a.7.7.1 * 3e-10 12.2 %
:HMM:SCOP  1->96 2a3qA1 a.204.1.2 * 5.2e-15 34.4 %
:HMM:PFM   27->91 PF03819 * MazG 2.2e-12 44.8 58/74  
:HMM:PFM   4->44 PF01031 * Dynamin_M 0.00093 17.1 41/296  
:BLT:SWISS 14->77 YPJD_BACSU 6e-05 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30551.1 GT:GENE ACD30551.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(594261..594590) GB:FROM 594261 GB:TO 594590 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30551.1 GB:DB_XREF GI:187712254 LENGTH 109 SQ:AASEQ MQIKQAQQTIAELFKDIIHPRLASFIALSEEVGELANEIMKKEIYEETNDNQKIKAELTDVFVSLLELANVYNIDLETEFIEKIQTLEPRVQQWNKAKALLKAKRTKLD GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 14->77|YPJD_BACSU|6e-05|37.5|64/100| SEG 96->108|kakallkakrtkl| BL:PDB:NREP 1 BL:PDB:REP 25->77|2q9lD|3e-05|41.5|53/78| RP:PDB:NREP 1 RP:PDB:REP 1->90|2a3qA|2e-06|25.0|88/112| HM:PFM:NREP 2 HM:PFM:REP 27->91|PF03819|2.2e-12|44.8|58/74|MazG| HM:PFM:REP 4->44|PF01031|0.00093|17.1|41/296|Dynamin_M| RP:SCP:NREP 1 RP:SCP:REP 19->92|1ugoA|3e-10|12.2|74/99|a.7.7.1| HM:SCP:REP 1->96|2a3qA1|5.2e-15|34.4|96/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 85.3 SQ:SECSTR ccHHHHHHHHHHHHHTccHHHHHcHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHH################ PSIPRED ccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccc //