[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30556.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   86->199 3b8eA PDBj 6e-04 15.2 %
:HMM:PFM   71->163 PF04955 * HupE_UreJ 0.00023 18.8 85/180  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30556.1 GT:GENE ACD30556.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(600122..600721) GB:FROM 600122 GB:TO 600721 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30556.1 GB:DB_XREF GI:187712259 LENGTH 199 SQ:AASEQ MFNNYNLLTTNLFVVYLILRIFTFLPKRLLLLAILILLCFNFISITSDNQTIFYFVTGFINYFSFSSFILLIFIIATTFASKRITIFPYTSIAFLLIIFIFYGSFFIVSYSLYDIGYSAYLVLACVFAYGLILLVISNRFILFNIIIVIATVAYFSGILHGNIWDYLLDPILLVICIIEISRALITTKNKQHKDKIIYY GT:EXON 1|1-199:0| TM:NTM 5 TM:REGION 16->38| TM:REGION 55->77| TM:REGION 89->111| TM:REGION 127->149| TM:REGION 166->187| SEG 3->12|nnynllttnl| SEG 29->38|llllailill| SEG 63->75|fsfssfillifii| RP:PDB:NREP 1 RP:PDB:REP 86->199|3b8eA|6e-04|15.2|105/998| HM:PFM:NREP 1 HM:PFM:REP 71->163|PF04955|0.00023|18.8|85/180|HupE_UreJ| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 52.8 SQ:SECSTR #####################################################################################ccccHHHHHHHHHHHHHHHHHHccccccccTTcccHHHHHHHHHHHHHHHHHcTTGGG#########cccccccTTTTTTTTHHHHHHHHHHHHHHHHHHHHcccccHHHHTcc DISOP:02AL 25-25,31-32,34-34,39-39,59-59,62-62,67-67,129-130,132-132,137-137,165-165,171-171,179-179,185-185,188-188,199-200| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //