[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30563.1
DDBJ      :             ABC transporter, ATPase component
Swiss-Prot:LOLD_FRATT   RecName: Full=Lipoprotein-releasing system ATP-binding protein lolD;         EC=3.6.3.-;

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:231 amino acids
:PSIPRED
:BLT:PDB   5->225 1l2tB PDBj 3e-42 42.5 %
:RPS:PDB   5->224 3b5jA PDBj 2e-37 22.8 %
:RPS:SCOP  6->222 1sgwA  c.37.1.12 * 9e-36 15.8 %
:HMM:SCOP  9->224 1ii8.1 c.37.1.12 * 5.8e-60 37.6 %
:RPS:PFM   54->174 PF00005 * ABC_tran 4e-16 42.1 %
:HMM:PFM   49->174 PF00005 * ABC_tran 2.5e-27 43.0 114/118  
:HMM:PFM   25->66 PF03193 * DUF258 1.1e-05 31.7 41/161  
:BLT:SWISS 1->231 LOLD_FRATT e-122 100.0 %
:PROS 147->161|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30563.1 GT:GENE ACD30563.1 GT:PRODUCT ABC transporter, ATPase component GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 612643..613338 GB:FROM 612643 GB:TO 613338 GB:DIRECTION + GB:PRODUCT ABC transporter, ATPase component GB:PROTEIN_ID ACD30563.1 GB:DB_XREF GI:187712266 LENGTH 231 SQ:AASEQ MNDVVLSCKNVSKKYTEFKTDIAILKDVNLEIKKGEKVAILGLSGSGKTTLLNVLGGLDKCSAGEVYLMGERFDNQSVNKRAKMRNKHLGFIYQLHHLLPEFTAIENVMIPLAITKKYTKKESIKLANEILKKVGLDHRADHKPAELSGGERQRVAIARALVTNPNCILADEPTGNLDSQRSESIFALMQQLSDDFGTSFVIVTHDEKLASRMNKIYRLVDGELELVINSN GT:EXON 1|1-231:0| SW:ID LOLD_FRATT SW:DE RecName: Full=Lipoprotein-releasing system ATP-binding protein lolD; EC=3.6.3.-; SW:GN Name=lolD; OrderedLocusNames=FTT0405; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->231|LOLD_FRATT|e-122|100.0|231/231| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 147->161|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 41->52|lglsgsgkttll| BL:PDB:NREP 1 BL:PDB:REP 5->225|1l2tB|3e-42|42.5|221/232| RP:PDB:NREP 1 RP:PDB:REP 5->224|3b5jA|2e-37|22.8|215/243| RP:PFM:NREP 1 RP:PFM:REP 54->174|PF00005|4e-16|42.1|114/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 49->174|PF00005|2.5e-27|43.0|114/118|ABC_tran| HM:PFM:REP 25->66|PF03193|1.1e-05|31.7|41/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 6->222|1sgwA|9e-36|15.8|196/200|c.37.1.12| HM:SCP:REP 9->224|1ii8.1|5.8e-60|37.6|210/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 34056 OP:NHOMOORG 1162 OP:PATTERN JIF8HGGCPPROPMSHdDINHLIQeFHVXGSNE9BEFBFEFC9LMKLYIO*tY7KRKKKIKBA4Q158 JQLB*RQSbbdHMIOGHEE-ES55I*EEEEEBdXYXUv**GeJicmXPbUPIlggGJS67SVTXnag*q*MXQPPtWUSGUOTA9BAALKKG3FBCC--9BLCDDQDOCI77777779BA9999ELIHKLGHMLNKSTUddFFEZMWPRbOOULUIKCAC8DBORNTdhhPBEACAACDBBB8MKIGFda7HUk********s*******sllmo***VUd*vWXjghdee**RcddddaabbcccbZRZWVSkWRUjiTJPPUZYJKZcPPNPZbUXZgdggeZfbfeikigddgkehgSRRRQSSTSSSRRkaXUTVYXZZa*k*********Y*ZYyrrRXXV*hclinWXOF**bfRUfeQTZUdVFeXKMOOJJGBDCADTO***JJY*nl*dv*wzzu*svw*-WX*VUzXt**J8*************wCBFr***t***z*JIJJJJJJaJLBGQKn44355555335456665566565555453EAABBBt**nx******nlkmf****sorrVr***rr*n8IkkciYdXbxl*z**OdVJOFKXODDFDDEEKKGPTVXm*HYOgZMUmUSaFTTQPLPTPNLKLMZeQfHMHPFLKKMJGCDCCCDCCCDRDEDGGiejKlKXCMJqLNRROGNVOOOPNPSORVT5-AENLI1--222yp**Q*iottqpspslm-ronnopqnnosspnonnnk*****ZYYbeaaabbbbbaabaab*iefhhhmN2mtvtwwvtuwwv33DDDECDEIHJJIDud*UUTTVUHMOLLQKNZJKMLKDNGJQePnlmns***ktvouV***EFDBCEDCFGalksiijjiuuqqqJJFEEFECDC777745BOMMEFFF87566667r8PA9898-B7DDDD8NML8DG9E9665TYhOTc*dcZ9OG 1---FG5-64136AB4441-563545445-33347413332225443444456742623422212232114235322113432322-1-221421-232311287614-N66A8EC763115A4KG2H1a*K1J8B5263B369B56143B32a5865Q8Eh8O9E4VFG*BIB55221U33526I87a1IC72MFHJ- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccEEEEEEEEEEEccccEEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEEEEEccc //