[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30580.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:272 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30580.1 GT:GENE ACD30580.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 639641..640459 GB:FROM 639641 GB:TO 640459 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30580.1 GB:DB_XREF GI:187712283 LENGTH 272 SQ:AASEQ MKRLFAILVFVLLVSVSFGKDIIKYPLIESNVLCDSVRPFCGDNCSNMPFYPTLCKPTEYGSAWSGGGATTATKQLYCAKATYANCHYSGSPKATGINPNNQVMPCKVSEDGKTANCRCKVFTGPNYVNIDGIMNLGVYYKTVAVCGKDGSKCKNLFTCLPDGSGDCKGVEAPVCKYIANQNTQDDSISFIPGADLISTYGFDMNKDYDIAKPGEGVKCQNIDVAGCMTQPCKYEKGSKEYATCSCPITNMKTMMLSQKGVSCDLPKGYVWE GT:EXON 1|1-272:0| SEG 8->18|lvfvllvsvsf| SEG 61->73|gsawsgggattat| OP:NHOMO 12 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121111112---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 81-81,87-88,90-90,95-95,109-110,115-116,118-118,123-123,143-143,146-146,151-151,157-158,160-160,165-165| PSIPRED ccHHHHHHHHHHHHHHHHcHHHHHccccccccHHccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEEccccccccEEEEEEEcccEEEEHHEEEccEEEEEEEEEccccHHHHHHHHcccccccccccccccHHHHHHccccccccEEEEccHHHHHHHcccccccccccccccccEEEcEEEccccccccccccccccEEEEEccccHHHHHHHHccccccccccccccc //