[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30584.1
DDBJ      :             putative spermidine synthase
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  366/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->288 2pt9C PDBj 6e-46 39.6 %
:RPS:PDB   25->243 3c6kD PDBj 1e-44 25.7 %
:RPS:SCOP  8->287 1inlA  c.66.1.17 * 4e-78 33.7 %
:HMM:SCOP  2->290 1inlA_ c.66.1.17 * 6e-89 36.8 %
:RPS:PFM   23->240 PF01564 * Spermine_synth 8e-53 47.2 %
:HMM:PFM   15->243 PF01564 * Spermine_synth 2.2e-77 39.9 228/246  
:BLT:SWISS 8->287 SPEE_SHISS 5e-89 52.5 %
:PROS 85->98|PS01330|SPERMIDINE_SYNTHASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30584.1 GT:GENE ACD30584.1 GT:PRODUCT putative spermidine synthase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 647430..648299 GB:FROM 647430 GB:TO 648299 GB:DIRECTION + GB:PRODUCT putative spermidine synthase GB:PROTEIN_ID ACD30584.1 GB:DB_XREF GI:187712287 LENGTH 289 SQ:AASEQ MIANINNKKIFHETLYHSYHQSIAISEILYEHKTDYQHLVIFNNPIFGNVMVLDGIVQTTEKDEFIYHEMLVHVPVIAHGNVKNILIIGGGDGGMLREALSHKAVESVTLVEIDQAVIDMCQEYFPGHSKGAFDHPKAKIVIQDGCEFVKNPPRKYDLIICDSTDPIGPGEVLFTSKFYKDCKEALNPGGIMVTQNGVIYFQIDELKKTLERFEPLYKDVSFYTAAVPTYVGGSMAFGWGTDELSYRNHDIQVIAQRFLKSGIKTKYYNPAIHIAAFALPQYVIDTLKK GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 8->287|SPEE_SHISS|5e-89|52.5|280/288| PROS 85->98|PS01330|SPERMIDINE_SYNTHASE_1|PDOC01033| SEG 85->94|iliigggdgg| BL:PDB:NREP 1 BL:PDB:REP 22->288|2pt9C|6e-46|39.6|260/280| RP:PDB:NREP 1 RP:PDB:REP 25->243|3c6kD|1e-44|25.7|214/348| RP:PFM:NREP 1 RP:PFM:REP 23->240|PF01564|8e-53|47.2|212/226|Spermine_synth| HM:PFM:NREP 1 HM:PFM:REP 15->243|PF01564|2.2e-77|39.9|228/246|Spermine_synth| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF01564|IPR001045| RP:SCP:NREP 1 RP:SCP:REP 8->287|1inlA|4e-78|33.7|267/285|c.66.1.17| HM:SCP:REP 2->290|1inlA_|6e-89|36.8|285/295|c.66.1.17|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 774 OP:NHOMOORG 592 OP:PATTERN 111112111111111122111111-----------11111111----1------11111111111--- -1------111----1111-1---1-111111-1111111---1--------------------122111-------------21111-----------------1----------------------------2----------12-1-11111111111211------2111111111111---1122-121222222111212221111111221222-111------111-------------------------------------------------------11111111111----------------------111111-------1-1-111-111111--21111221212--2111211-1-2-----------------1---------------------------1-------------------1------1-1111111111111--1----------------------------------------22222211111111-111111211-1-2------11222---1---1-------------11-1111-2-----------------------1-11-1-----------------------1-11--1-11---2-1---------------------12111--1111111-111111111111-11111111111111111111111111-1111111111111111111111111-111111111111--11---------1111--------------------------1-2222--1------1111-1111-1111--------------11111111111111--1-112221------------------------------------1111111111--- 11--111-3-1-1121111111111111111111111111111111111111111-11111122212222222222221222222211-21111211111111111-122112111-1-3-11111-21171-111-11111111-11--11122111222221211211312212222N2221254691743732122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 100.0 SQ:SECSTR ccccccTTcEEEEccTTcTTEEEEEEEEEEEEEccccEEEEEEETTTEEEEEETTEEEEETTcHHHHHHHHTTTTccccTTccEEEEEEcTTcHHHHHHHTTccccEEEEEEccHHHHHHHHHHccccGGGccEETTEEEEEccHHHHHHHHTccEEEEEEEccccccccHHHHHHHHHHHHHHTEEEEEEEEEEEEETTcHcHHHHHHHHHTTcccccEEEEEEEcGGGcccEEEEEEEEEcEEETTccTTcccccGGGTTGGcccccHHHHHHHTcccGGGGGGTcG DISOP:02AL 288-290| PSIPRED cccccccccEEEEEEccccEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHccccccEEEEEccccccccHHHccHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEccccccccccHHHHHHHHHHcccccccccHHHHHHHHHcHHHHHHHHcc //