[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30593.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  286/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->92 PF03692 * UPF0153 4e-08 26.2 65/85  
:BLT:SWISS 5->129 YCGN_SHIFL 2e-36 48.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30593.1 GT:GENE ACD30593.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(660969..661418) GB:FROM 660969 GB:TO 661418 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30593.1 GB:DB_XREF GI:187712296 LENGTH 149 SQ:AASEQ MMSKWWQQIDLKDMSSEQWESICDRCGLCCLNKLQDDETDEVYYTRVSCKLLDIGKCQCSMYQKRKQLVPECVNLTYKQLKNHAHKWLPNSCSYKLLFEGKDLPDWHHLNTSSTEEMHKQKKSAKHFAISEYELDVDEYLEDFIIKIDN GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 5->129|YCGN_SHIFL|2e-36|48.8|123/153| SEG 131->142|eyeldvdeyled| HM:PFM:NREP 1 HM:PFM:REP 23->92|PF03692|4e-08|26.2|65/85|UPF0153| OP:NHOMO 287 OP:NHOMOORG 286 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-11-1111111111111111111111111-11111111111-11111111111111111111111111111111111111111-1------------------------------11111--------------------------------------------------------------------------------------111-11121-----------------------------------111111111111111111111111111111---11-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------1111111111111111111111111111111111111111111111111111111111111111111111111----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 148-150| PSIPRED ccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHcccccccccHHHHHHHcccHHcccHHHHHcccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHccccc //