[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30605.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:385 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->71 PF07219 * HemY_N 2.1e-05 23.9 71/134  
:BLT:SWISS 142->337 YL764_MIMIV 8e-05 20.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30605.1 GT:GENE ACD30605.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 675080..676237 GB:FROM 675080 GB:TO 676237 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30605.1 GB:DB_XREF GI:187712308 LENGTH 385 SQ:AASEQ MIKVFKLIIAVALATLVGIWATKYHCYIMLVLADKTIKMNLVAFVFITFILLFILILGVRIIVSVFRFPYLLFSWVIGLFSVDKQERFADIVADITLENNRLVKKFSIGHILRLTPKHLKEYVLFRKLNLIAVTQDIKELEKALKHIDSKTFTYKFFEVYKLYLVQKFSEAQTKISIMLEKNDPRFMPNIVNLAGNIALADGDDAFALKILEKYDAYLKEDLEENLIILALKSAKDVAKLNDIYNKSDTTKALSTVYLEQLIKFGEMVSAEKFAKKQLANLNISAEMLKLYINAFNMPISRLCDKVLDRANHDYNSILTLLDFAMIKSDNYCFKIIYDYIERHLKDFLSAAELEKYFHILCKFFIKNGEVAGIDLSVTRLVYTNN GT:EXON 1|1-385:0| BL:SWS:NREP 1 BL:SWS:REP 142->337|YL764_MIMIV|8e-05|20.9|187/647| TM:NTM 3 TM:REGION 1->20| TM:REGION 31->53| TM:REGION 63->85| SEG 41->63|lvafvfitfillfililgvriiv| HM:PFM:NREP 1 HM:PFM:REP 1->71|PF07219|2.1e-05|23.9|71/134|HemY_N| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 385-386| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcEEcccHHHHHHccccEEEEcHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccccccHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEcc //