[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30607.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.52
:235 amino acids
:PSIPRED
:RPS:SCOP  136->203 1utaA  d.58.52.1 * 4e-09 19.1 %
:HMM:SCOP  131->203 1utaA_ d.58.52.1 * 4.1e-10 24.7 %
:HMM:PFM   135->199 PF05036 * SPOR 1.4e-12 20.0 65/76  
:HMM:PFM   32->159 PF11271 * DUF3068 0.00012 18.6 118/301  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30607.1 GT:GENE ACD30607.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(677087..677794) GB:FROM 677087 GB:TO 677794 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30607.1 GB:DB_XREF GI:187712310 LENGTH 235 SQ:AASEQ MKDLSRLDIPKKTAKDNSQEPQQPKNTKKKKILITIVVCLLVVAVASKLVNKHLKKIKAEQEKAKIELQAEKNQKLKTLDNKQSSEATNHQTADLSSKDNPSNDKMVFTFYNNLKHDSVEVDVVPEAQRAQYKYTYIYQIASFRNMDETSWYVKKMKEDGLNPQFERVGNWIRMYIGPYDSKRAMAPDIIKLQRIGLNGGFPREVSRTKIEPKDNNKVSDSKSSDKDLTNNNSKS GT:EXON 1|1-235:0| TM:NTM 1 TM:REGION 32->54| SEG 25->52|kntkkkkilitivvcllvvavasklvnk| SEG 54->72|lkkikaeqekakielqaek| SEG 213->234|kdnnkvsdskssdkdltnnnsk| HM:PFM:NREP 2 HM:PFM:REP 135->199|PF05036|1.4e-12|20.0|65/76|SPOR| HM:PFM:REP 32->159|PF11271|0.00012|18.6|118/301|DUF3068| RP:SCP:NREP 1 RP:SCP:REP 136->203|1utaA|4e-09|19.1|68/77|d.58.52.1| HM:SCP:REP 131->203|1utaA_|4.1e-10|24.7|73/0|d.58.52.1|1/1|Sporulation related repeat| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccEEEEEEEccccccEEEEEEccccccccEEEEEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHEHHHHcccccccccccccEEEEEEEcccccccccHHccccccccccccccccccccccccccccc //