[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30610.1
DDBJ      :             prophage repressor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
a.35.1b.87.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->191 1jhhA PDBj 2e-05 36.4 %
:RPS:PDB   8->217 3bdnA PDBj 6e-17 17.2 %
:RPS:SCOP  8->61 1x57A1  a.35.1.12 * 8e-06 22.2 %
:RPS:SCOP  74->217 1jhcA  b.87.1.1 * 3e-15 28.8 %
:HMM:SCOP  8->65 2a6cA1 a.35.1.13 * 4.2e-06 31.0 %
:HMM:SCOP  71->213 1jhfA2 b.87.1.1 * 4.6e-18 29.6 %
:HMM:PFM   11->45 PF01381 * HTH_3 2.1e-08 42.9 35/55  
:HMM:PFM   136->194 PF00717 * Peptidase_S24 9.9e-08 28.3 53/70  
:BLT:SWISS 71->191 LEXA_BACA2 2e-09 38.8 %
:PROS 1->117|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30610.1 GT:GENE ACD30610.1 GT:PRODUCT prophage repressor protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(680350..681003) GB:FROM 680350 GB:TO 681003 GB:DIRECTION - GB:PRODUCT prophage repressor protein GB:PROTEIN_ID ACD30610.1 GB:DB_XREF GI:187712313 LENGTH 217 SQ:AASEQ MFNYKTDLKPALKRVGMKQIELAKKLGKSDRTIKGWVAGTNCPSYDGHIEVMRILGLKDNYCPSDTSIITVTNVPVLSYVQAGEFTESQENIDPIDYLQIPDTLVPKNGFSLQVQGESMLYDFSESQLLNPKYSKYTIYEGENILVDPNQVNPQDLIDKVVVARNSDGATVKLLYKDNNRLYLMPLNSKLQNNDEIKSPADAVIIGRVVKSFNIRSF GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 71->191|LEXA_BACA2|2e-09|38.8|103/206| PROS 1->117|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| BL:PDB:NREP 1 BL:PDB:REP 74->191|1jhhA|2e-05|36.4|99/197| RP:PDB:NREP 1 RP:PDB:REP 8->217|3bdnA|6e-17|17.2|203/234| HM:PFM:NREP 2 HM:PFM:REP 11->45|PF01381|2.1e-08|42.9|35/55|HTH_3| HM:PFM:REP 136->194|PF00717|9.9e-08|28.3|53/70|Peptidase_S24| RP:SCP:NREP 2 RP:SCP:REP 8->61|1x57A1|8e-06|22.2|54/78|a.35.1.12| RP:SCP:REP 74->217|1jhcA|3e-15|28.8|125/130|b.87.1.1| HM:SCP:REP 8->65|2a6cA1|4.2e-06|31.0|58/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 71->213|1jhfA2|4.6e-18|29.6|125/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------11-----------------------------1------1-1-1-1---1----1----11------1--1------------------------1---------------1--------------------------------------1-------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------1-----------------------------------------------------------------------------------------------------11------------------ STR:NPRED 216 STR:RPRED 99.5 SQ:SECSTR cccHHHHHHHHTTTTTcccHHHHHHHTccHHHHHHHTTTTcccHHHHTccGGGTcHHHHHHHHHHHHHHHcccccccccccccccccccccTTTTcccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccc#ccccTTcEEEEEcTTTccccEEEEccccccEEEcccTTccccccccTTcccEEEEEEEEccccccc DISOP:02AL 217-218| PSIPRED cccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccHHcccccEEEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccEEEEEEEEEccEEEEEEccccccccccccccccEEEEEEEEEEEEcccc //