[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30623.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.100.1
:238 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->237 2i76A PDBj 1e-04 27.1 %
:RPS:SCOP  143->237 2i76A1  a.100.1.10 * 2e-15 22.6 %
:RPS:PFM   138->231 PF10728 * DUF2520 8e-08 37.0 %
:HMM:PFM   127->227 PF10728 * DUF2520 2.3e-15 33.0 100/132  
:BLT:SWISS 8->73 YFK9_YEAST 9e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30623.1 GT:GENE ACD30623.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(697807..698523) GB:FROM 697807 GB:TO 698523 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30623.1 GB:DB_XREF GI:187712326 LENGTH 238 SQ:AASEQ MQQVPRYVIVGNGNVAAHMCYYFECLKLDFRQWSRNESLDQLDKLLDNATHVLVLIKDSEIQNFVDRHLTNKSKRLIIIHFSGLLDIKNAYSAHPLQSFPDKNLYSLDEYKSIAFVTCDRSIAFSELLPKLPNANFCIDKSQKAYYHAMCVLANNVSTLIWQKFYTEMQNRFGINQGYLIPFLETTFKNIKHNHHALSGPIARGDNLTLQKDLDALIGDDFYDVFRAIVNQFSNKEKG GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 8->73|YFK9_YEAST|9e-04|33.3|57/100| BL:PDB:NREP 1 BL:PDB:REP 10->237|2i76A|1e-04|27.1|214/244| RP:PFM:NREP 1 RP:PFM:REP 138->231|PF10728|8e-08|37.0|92/132|DUF2520| HM:PFM:NREP 1 HM:PFM:REP 127->227|PF10728|2.3e-15|33.0|100/132|DUF2520| RP:SCP:NREP 1 RP:SCP:REP 143->237|2i76A1|2e-15|22.6|93/103|a.100.1.10| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 89.9 SQ:SECSTR #########EcccHHHH###HHHHTTcccc###EEcccHHHHHHHHHTcccccccccccccEEEcTTTHHHHHTTTcEEEccccccGGcEEEEEEcccccTTGG####GGGGccEEEcTTTHHHHHHHHHHcccEEEccGGGHHHHHHHHHHHHTHHHHHHHHHHHTT####TcccHHHHHHHHHHHHHHHHcGGGcccHHHHTcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHH# PSIPRED cccccEEEEEcccHHHHHHHHHHHHHcccHHEcccHHHcccHHHHHccccEEEEEccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccHHHcccccEEEEEccHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccc //