[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30629.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  275/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->225 2qy6A PDBj 2e-38 43.1 %
:RPS:PFM   122->226 PF05430 * DUF752 1e-22 43.8 %
:HMM:PFM   122->225 PF05430 * DUF752 1.4e-34 39.8 103/124  
:BLT:SWISS 4->222 MNMC_LEGPA 7e-43 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30629.1 GT:GENE ACD30629.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 707205..707891 GB:FROM 707205 GB:TO 707891 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30629.1 GB:DB_XREF GI:187712332 LENGTH 228 SQ:AASEQ MEFAKIIWEKNTPKSVSFDDFYFSTTSGIQESIYNFLVHNDLQQRFSQLQNKQYFRICETGFGSGLNFILTKNLWHKYVINDSQLEFISFEKFPITINDLRKILNSFAELDGYQSFVEQYNPIDGLNIYKFDNITLKLITDDVNNINHYNLPVIDAWFLDGFSPTKNSLMWSDNLFDNISKLCHNHSSFATFTASSKVRKALQKYGFKVKKDKGFGNKREMMYGVFMS GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 4->222|MNMC_LEGPA|7e-43|43.8|219/666| BL:PDB:NREP 1 BL:PDB:REP 10->225|2qy6A|2e-38|43.1|211/244| RP:PFM:NREP 1 RP:PFM:REP 122->226|PF05430|1e-22|43.8|105/124|DUF752| HM:PFM:NREP 1 HM:PFM:REP 122->225|PF05430|1.4e-34|39.8|103/124|DUF752| OP:NHOMO 276 OP:NHOMOORG 275 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------1-1---1-111---1--11-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------111111111111--1111111111111---------------------------------------------------111-1------1111111111111111111111--1111-11111111---111-111---------1111---------------------------------1-11111111---------1------11111111111---------------------1---1------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----1111--111111111112111111111111111111111111111111111111--1-111-1111-1111111111----------------1-111111111111-1----------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 96.1 SQ:SECSTR #########TccEEETTTTEEcccTTTHHHHHHHHHHHHTTHHHHGGGcccccEEEEEEcccTTcHHHHHHHHHHHHHTccccEEEEEEEEcccccHHHHHHHHTTcGGGHHHHHHHHHTccccEEEEEEEccEEEEEEEccHHHHGGGTTcEEEEEEEccccTTTcGGGccHHHHHHHHHHEEEEEEEEEccccHHHHHHHHHHTEEEEEEcccTTcccEEEEEEEE DISOP:02AL 228-229| PSIPRED cccccccccccEEccccccccccccccHHHHHHHHHcccccHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHcccccHHHHHHHHccccccccEEEcccEEEEEEEEcHHHHHHcccccEEEEEEcccccccccHHccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEcccccccEEEEEEEcc //