[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30630.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:94 amino acids
:PSIPRED
:RPS:SCOP  13->76 1mwqA  d.58.4.7 * 2e-08 26.6 %
:HMM:SCOP  1->86 1mwqA_ d.58.4.7 * 5.7e-12 18.6 %
:HMM:PFM   12->76 PF03795 * YCII 4.8e-10 33.8 65/95  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30630.1 GT:GENE ACD30630.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(707881..708165) GB:FROM 707881 GB:TO 708165 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30630.1 GB:DB_XREF GI:187712333 LENGTH 94 SQ:AASEQ MQIHIIDIHYLATQEEIAKVRPLHRDFLDIGYNKGIFIASGPKTSKTGGIIIAHGDIQEIKEFIKDDPFHTNKVVEYHFTSFDAVKHIPELANS GT:EXON 1|1-94:0| HM:PFM:NREP 1 HM:PFM:REP 12->76|PF03795|4.8e-10|33.8|65/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 13->76|1mwqA|2e-08|26.6|64/100|d.58.4.7| HM:SCP:REP 1->86|1mwqA_|5.7e-12|18.6|86/100|d.58.4.7|1/1|Dimeric alpha+beta barrel| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1--------------------1---------------------------------------------------------------------------1--------------------------------------111-----------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------1------------1----------------------1---------1---1------------------------------------------------------------1---------------------111--1-1111111111111111-----------------------------------------------------1--1----1----1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------1-111111------------------------------------1111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEEEccHHHHHHHHHccccccccEEEEEEEEEEEEEEccccccc //