[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30638.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:HMM:PFM   60->167 PF02620 * DUF177 2.6e-19 29.9 107/119  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30638.1 GT:GENE ACD30638.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(714128..714631) GB:FROM 714128 GB:TO 714631 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30638.1 GB:DB_XREF GI:187712341 LENGTH 167 SQ:AASEQ MKGKHSQINYSIYAKQKRELEDIEITIEQLNQISDFITANPHTFVCSFSFFEEKNHACIKYSIKAKLQLICQDSLEVFEHDFNITNTIIITEDDRLVEDSLYEPFICNSAIIDLKDIIKEEILLDLPLIPKKDTSTCKNTKKHSYYSEQESVIQEKKNPFEILKTLK GT:EXON 1|1-167:0| SEG 83->91|nitntiiit| SEG 111->133|iidlkdiikeeilldlplipkkd| HM:PFM:NREP 1 HM:PFM:REP 60->167|PF02620|2.6e-19|29.9|107/119|DUF177| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccHHHEEEHHHcccEEEEEcHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEcccccccccccccEEEEccccccHHHHHHHHHHHHccccccccHHHccccccccccccccHHHcccccHHHHHHHcc //