[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30647.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->119 1cmoA PDBj 2e-06 12.7 %
:RPS:SCOP  9->127 1kp9A  c.66.1.18 * 1e-05 20.7 %
:HMM:SCOP  57->162 1vlmA_ c.66.1.41 * 9.6e-08 19.0 %
:HMM:PFM   55->102 PF08241 * Methyltransf_11 0.00015 19.1 47/95  
:HMM:PFM   125->156 PF05445 * Pox_ser-thr_kin 0.00052 25.0 32/434  
:BLT:SWISS 46->114 CT007_HUMAN 3e-04 39.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30647.1 GT:GENE ACD30647.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 729744..730334 GB:FROM 729744 GB:TO 730334 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30647.1 GB:DB_XREF GI:187712350 LENGTH 196 SQ:AASEQ MIKKERIITRYLSQRWYKKALIITATESNYFHNINVLKLVACSGYLKNQSPLGCIFDIEAWPFENKFFDLIILDESFVSCPKQMRALFNQLHFCLSDDGEVIVACVGGISLYGLLSRFLANGFTSKKVRLINYTNNFIVNIIKKIISKNYVVVFKKDNYFRVDPLNVSELVDKPLKAKVYSGGCAREIYGNFQKEK GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 46->114|CT007_HUMAN|3e-04|39.7|68/345| SEG 135->153|nnfivniikkiisknyvvv| RP:PDB:NREP 1 RP:PDB:REP 57->119|1cmoA|2e-06|12.7|63/127| HM:PFM:NREP 2 HM:PFM:REP 55->102|PF08241|0.00015|19.1|47/95|Methyltransf_11| HM:PFM:REP 125->156|PF05445|0.00052|25.0|32/434|Pox_ser-thr_kin| RP:SCP:NREP 1 RP:SCP:REP 9->127|1kp9A|1e-05|20.7|111/270|c.66.1.18| HM:SCP:REP 57->162|1vlmA_|9.6e-08|19.0|105/0|c.66.1.41|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 63.3 SQ:SECSTR #######HHHHHHHTTccEEEEEEcccHHHHHHHHHHHHHHHHHHHTTTcEEEEEEHccccccccccccEEEcccTTcccccccccccEEEEcccccccccEEEEcccTTccccccTTcEEEEETTEEEcc################################################################# DISOP:02AL 17-18,20-20,25-26,31-32,34-34,59-60,62-62,95-95,101-102,104-104,151-151,157-157,160-160,165-165,171-171,174-174| PSIPRED cccHHHHHHHHHHHHHHHEEEEEEEEccccEEcccEEEEEEEccccccccccEEEEEEEcccccccEEEEEEEccHHHccHHHHHHHHHHHHHEEcccccEEEEEEccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccEEEEccccHHHHHcccHHHEEEccccHHHHHccccccc //