[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30652.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:290 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   17->274 2bhtC PDBj 6e-04 11.8 %
:RPS:SCOP  14->287 1j0aA  c.79.1.1 * 3e-18 20.2 %
:HMM:SCOP  12->288 1rqxA_ c.79.1.1 * 3.1e-40 23.6 %
:RPS:PFM   4->121 PF09817 * DUF2352 8e-04 27.7 %
:HMM:PFM   15->189 PF00291 * PALP 1.8e-06 19.9 156/297  
:BLT:SWISS 17->277 1A1D_THEMA 1e-11 28.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30652.1 GT:GENE ACD30652.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(733519..734391) GB:FROM 733519 GB:TO 734391 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30652.1 GB:DB_XREF GI:187712355 LENGTH 290 SQ:AASEQ MLSLFQKISFENKDFIVMRDDLSHPIFSGNKARKLAYLLNNPEKYSHIQTIISFGGNQSNFMLALSQLAELKGWNFHYWIKPLPKFLRQTKNGNLKLALDNGMQLFETLSSLNLEKIKANYHTDSSLYFFDQGGRNTLAEQGIAECAKEIKKYCKQNNIDDYSVIVASGTGTTALYLEKYLPYKVYTIPCVGSSDYLKEQFNNIDSDLVHPKIISPNFKNNFGQLDIANYNIYLKLLRETKIEFDLLYDPIAWRTLLSKYHQLPKPIIYIHCGGVSGNQTMLARYQRFSQ GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 17->277|1A1D_THEMA|1e-11|28.4|250/312| RP:PDB:NREP 1 RP:PDB:REP 17->274|2bhtC|6e-04|11.8|245/291| RP:PFM:NREP 1 RP:PFM:REP 4->121|PF09817|8e-04|27.7|112/530|DUF2352| HM:PFM:NREP 1 HM:PFM:REP 15->189|PF00291|1.8e-06|19.9|156/297|PALP| RP:SCP:NREP 1 RP:SCP:REP 14->287|1j0aA|3e-18|20.2|267/325|c.79.1.1| HM:SCP:REP 12->288|1rqxA_|3.1e-40|23.6|276/338|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 72 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1111111111----------1-111-----------111111111111111111111---------------------------------------------------------------------------------------------------1----------------------------------------------------------111111111-111-1111111111--------------------------------------------------------------------1---- ------1-----------------------------------------------------------------------------------------------------2-------------------------------------------------------1----------1----------------11-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 84.5 SQ:SECSTR ################EEETTccTTcTHHHHHHHHHHHHHH#TcccTTcEEEEEc##ccHHHHHHHHHHHHHTcEEEEEEET######TccHHHHHHHHHTTcEEEEEcTTTHHHHHHHHHHHTTccEEccTTTcTTTHHHHHHTHHHHHHHTTTcc###ccEEEEEccccHHHHHHHHHHTTcccccEEEEcTTcccTTcccccGGGccTTccGGGccEEEEEcHHHHHHHHHHHHHHHcc#cccHHHHHHHHHHHTTTTTcccEEEEEEccc################ PSIPRED ccccccHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHcccEEEEccccHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHccccccEEEccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHcc //