[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30658.1
DDBJ      :             MFS family major facilitator transporter
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  383/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:467 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   82->286 2d33D PDBj 4e-21 7.6 %
:RPS:SCOP  17->212 1pw4A  f.38.1.1 * 8e-14 15.0 %
:HMM:SCOP  10->462 1pw4A_ f.38.1.1 * 6.8e-72 25.7 %
:RPS:PFM   27->461 PF00083 * Sugar_tr 8e-40 34.0 %
:HMM:PFM   23->465 PF00083 * Sugar_tr 7.5e-89 31.9 432/451  
:BLT:SWISS 21->463 YWTG_BACSU 3e-57 32.9 %
:PROS 75->92|PS00216|SUGAR_TRANSPORT_1
:PROS 117->142|PS00217|SUGAR_TRANSPORT_2
:TM
:REPEAT 2|10->204|255->448
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30658.1 GT:GENE ACD30658.1 GT:PRODUCT MFS family major facilitator transporter GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 739338..740741 GB:FROM 739338 GB:TO 740741 GB:DIRECTION + GB:PRODUCT MFS family major facilitator transporter GB:PROTEIN_ID ACD30658.1 GB:DB_XREF GI:187712361 LENGTH 467 SQ:AASEQ MALFLKEKRMKEANKLKVFMIIFFSAMGGMLYGYDIGIIGGALPFIKSELGMTAAQESFLGGSVLFGGAFAILIGGVLADIFGRKNMITASGLIFTISVFMIYSAESYNSLLFSRLIQGVAVGFISITVPLYLTESVPSMIRGLAVTCFQLFLTVGILISVAISLLFISNDPVTGLEIGDWRNMFLTALIPGLIVFVGGFLLIKSPRWLIMKNREQEAEKILTETIGIDAAKQQMQEVKILIEKTKNEGSLLSSLTKRHYLMPMFIVFSVAILAQMTGINSILQYAPTMLKETGLGSVYAAIVGGVAITSLNFVTTIIAVVIADKIERKFVITFGTLMVSIVLLTLAVLMYTMPDTSAKGMSLLIGFILYIFFFAIGPGAYIWVIMSELLPTNIRSKGLAVALFLNSMASAILASSVMPVTQHFNGNYGVILGICGVCTLVYSFIVFKFVPKTNGRTLEEIEQGFIK GT:EXON 1|1-467:0| BL:SWS:NREP 1 BL:SWS:REP 21->463|YWTG_BACSU|3e-57|32.9|429/457| PROS 75->92|PS00216|SUGAR_TRANSPORT_1|PDOC00190| PROS 117->142|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 12 TM:REGION 20->42| TM:REGION 61->83| TM:REGION 86->106| TM:REGION 111->133| TM:REGION 146->168| TM:REGION 183->205| TM:REGION 259->281| TM:REGION 298->320| TM:REGION 331->353| TM:REGION 364->386| TM:REGION 398->420| TM:REGION 429->451| NREPEAT 1 REPEAT 2|10->204|255->448| SEG 363->376|lligfilyifffai| RP:PDB:NREP 1 RP:PDB:REP 82->286|2d33D|4e-21|7.6|198/499| RP:PFM:NREP 1 RP:PFM:REP 27->461|PF00083|8e-40|34.0|421/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 23->465|PF00083|7.5e-89|31.9|432/451|Sugar_tr| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 17->212|1pw4A|8e-14|15.0|187/434|f.38.1.1| HM:SCP:REP 10->462|1pw4A_|6.8e-72|25.7|420/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 6122 OP:NHOMOORG 594 OP:PATTERN ------3622422148-111----1--1----------------1--1-----------1-853---- 52214112333-3-222----1--131----11111-19E----3122-222464221-----5--E231-1111211--2-2-1-11444212---------113-313-------------------------------111---1-------11---11--1----1--------1-----------1715333333442333323--4427232-1111---------2---------------11111--3-23-3---1311321-22341-------------------------------------------------22------------11--------------87-2-----2---------12112-----3-2----------22122122213------411-----11211-12--1521----1-------43444444355511---------------------------------1--2----28666674433344B7444413C2C575---343--1--12--2-12----1-1----------1--------1-1-1------11-11-1-----1---------------------------11-1-1-3114---------1----1-11-1--------------53-13225665545555-5546557556555555553767----17655566555657555623455331-1-------------1-111112222---2----1-1---------AA9892712-3144442231-33411222424324342----1----------221111111------------------------------------------------------1-11111-11 11--545-3421--4*qze***o****CDGIFFFFFIEDEGHHGGGicl*****tviZZVXULMkAILAIGMbGYTRHPTFMJLLT98-LXPqCTFkVdCN7HXJQ-372IVVHRJN84658I9LO6S7e*K1QJS7969M6EKA3A653F63O8OEIMHGT7GGMHRVd*99DH--23s5448ILs**n*TA6cZmm7 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 42.4 SQ:SECSTR #################################################################################ccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEEccT#######TcTTcccHHHHHHHHHHHHHHHHcccccccHHHHHHTHHHHHHHHHHTTccccEEHHHHHHHHHHHHHHHHHHHHHHHHHcGGGcHHHHHHHHHHHHHHHHHHHHHH##################################################################################################################################################################################### DISOP:02AL 467-468| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcc //