[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30663.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  627/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.194.1
:235 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   23->233 1rw0A PDBj 5e-34 38.1 %
:RPS:SCOP  13->235 1rv9A  d.194.1.2 * 6e-69 36.8 %
:HMM:SCOP  1->236 1rv9A_ d.194.1.2 * 2.3e-63 40.0 %
:RPS:PFM   18->233 PF02578 * Cu-oxidase_4 7e-41 45.3 %
:HMM:PFM   18->233 PF02578 * Cu-oxidase_4 2.3e-66 41.4 215/233  
:BLT:SWISS 18->235 Y175_HAEIN 3e-35 40.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30663.1 GT:GENE ACD30663.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 747083..747790 GB:FROM 747083 GB:TO 747790 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30663.1 GB:DB_XREF GI:187712366 LENGTH 235 SQ:AASEQ MSVVFVNTPFAKLKLGYTNNTQGFSKEKYAKFNLADNVGDKHLAVEKNRNLFKSYLNVDIKWLRQNHTNIVKSFDEYNGDFCDAIITDKPRQACVVLTADCLPIILFDKKMTKVAAIHAGWRGLSQGILEVALKEFVGLELVAWFGPCISANFYEVGSDVHDKFIEQHQAFGQAFRSKSEGKYLFDMKLVARQILNDNHCFYIVDSGLCTYSNKRFYSYRKEGVTGRQATFVWFE GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 18->235|Y175_HAEIN|3e-35|40.1|217/244| BL:PDB:NREP 1 BL:PDB:REP 23->233|1rw0A|5e-34|38.1|210/243| RP:PFM:NREP 1 RP:PFM:REP 18->233|PF02578|7e-41|45.3|212/233|Cu-oxidase_4| HM:PFM:NREP 1 HM:PFM:REP 18->233|PF02578|2.3e-66|41.4|215/233|Cu-oxidase_4| RP:SCP:NREP 1 RP:SCP:REP 13->235|1rv9A|6e-69|36.8|223/242|d.194.1.2| HM:SCP:REP 1->236|1rv9A_|2.3e-63|40.0|235/242|d.194.1.2|1/1|CNF1/YfiH-like putative cysteine hydrolases| OP:NHOMO 629 OP:NHOMOORG 629 OP:PATTERN -------------------------------------------------------------------- -11-11111111111---------1------11---1111-11---1-1---11111------1111-1-11---111-1--1111111111-1--1---------111---------------111111111111---------11-1-11-11--1111-111-111111-1-111-1-1---1-11111-1111111-111-111-1-111111--111111-------1111111-1--111--1-111----------------------------------------------------------------------111111111111-1-111111111-1--11111--111111-11111--1-1-111111111111111111111111111111111-11111111111-11111111111111111111111111111111111---11111----------111111111111111------1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111--1-1-1-11111111-11-1-------11-1111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111-111----------------------------1--1--------- --------------------------------------------------------------------------------------------------------------1----------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 96.6 SQ:SECSTR ########GGTTEEEEEEccccccccTTcccccccTTccccHHHHHHHHHHHHHHTTccccccccccccEEEcccccccccccEEEEccTTcEEEEEEcccEEEEEEETTcccEEEEEEcHHHHHHTHHHHHHHTccccGEEEEEcccccTTTcEEcHHHHHHHHTTcGGGGGGEEEETTTEEEEcHHHHHHHHHHHTTccEEEEccccTTTTTTcccTTTccccccEEEEEEEc PSIPRED cEEEEccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccEEEEccccccccccEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEccccccccEEEcHHHHHHHHHHcccccHHHcccccccEEEcHHHHHHHHHHHccccEEEEccccccccccEEcEEEcccccEEEEEEEEc //