[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30667.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:RPS:PFM   19->111 PF06903 * VirK 2e-12 43.3 %
:HMM:PFM   5->114 PF06903 * VirK 1.2e-34 37.4 107/119  
:BLT:SWISS 21->98 Y4WH_RHISN 3e-04 30.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30667.1 GT:GENE ACD30667.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(753187..753606) GB:FROM 753187 GB:TO 753606 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30667.1 GB:DB_XREF GI:187712370 LENGTH 139 SQ:AASEQ MKKIITLSTLLLISLTSIAFSKELNNYSDILNAVKDGKNITIFVDFSNCKPEIKVSGQFSPKSIMIHNDSIIFSDTHFTRNNPQYLNEPILEYVVYKINGNNVNITIDILDANNSPMEHSKRITIGCQITKDQASFFSN GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 21->98|Y4WH_RHISN|3e-04|30.7|75/100| TM:NTM 1 TM:REGION 4->26| SEG 4->18|iitlstlllisltsi| RP:PFM:NREP 1 RP:PFM:REP 19->111|PF06903|2e-12|43.3|90/117|VirK| HM:PFM:NREP 1 HM:PFM:REP 5->114|PF06903|1.2e-34|37.4|107/119|VirK| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEEccEEEEcccEEcccccccccccHHHEEEEEEcccccEEEEEEEccccccEEccccEEEEEEEEcccEEEEcc //