[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30669.1
DDBJ      :             transporter-associated protein, HlyC/CorC family
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  867/915 : Eukaryota  78/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.37.1
:280 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   54->186 3hf7A PDBj 8e-19 34.9 %
:BLT:PDB   195->270 2pliA PDBj 1e-12 38.7 %
:RPS:PDB   20->191 3bp1B PDBj 1e-26 7.6 %
:RPS:PDB   198->277 3dedB PDBj 1e-14 28.6 %
:RPS:SCOP  49->187 2v8qE1  d.37.1.1 * 2e-20 20.6 %
:RPS:SCOP  195->279 2pliA1  d.145.1.4 * 2e-19 35.7 %
:HMM:SCOP  51->113 1nf7A3 d.37.1.1 * 7e-11 33.9 %
:HMM:SCOP  122->201 1pvmA2 d.37.1.1 * 6e-09 25.6 %
:RPS:PFM   200->277 PF03471 * CorC_HlyC 3e-11 35.1 %
:HMM:PFM   201->277 PF03471 * CorC_HlyC 5.6e-25 34.2 76/81  
:HMM:PFM   56->113 PF00571 * CBS 3.1e-11 34.5 55/57  
:HMM:PFM   134->184 PF00571 * CBS 5.8e-08 25.5 51/57  
:BLT:SWISS 19->275 CORC_VIBCH 7e-51 39.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30669.1 GT:GENE ACD30669.1 GT:PRODUCT transporter-associated protein, HlyC/CorC family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(755342..756184) GB:FROM 755342 GB:TO 756184 GB:DIRECTION - GB:PRODUCT transporter-associated protein, HlyC/CorC family GB:PROTEIN_ID ACD30669.1 GB:DB_XREF GI:187712372 LENGTH 280 SQ:AASEQ MADNNPFIKRLTSSIFNIKSEEALIDAINRAAANEVIDKTSQNMLIGAMKISSLDVGDIMIAHTKIVAVDMSMSIREILKKTINSSHTRLPVYCENKSEILGILHSKDLLKLIFEKEIESADDEELKAEDIKNILRPAIFIPETKKLNAMLKDFKNSQNHIAIVVDEYGAISGLITIEDVLEEIVGDIEDEFDITSQNIVKMADDKFILDATTTIEDFNEYFATSIDDNSDYDTIAGMIIQTLECLPQKGDSIVVDGLKFTVQEADNRKIIKILVEKFKK GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 19->275|CORC_VIBCH|7e-51|39.7|247/291| BL:PDB:NREP 2 BL:PDB:REP 54->186|3hf7A|8e-19|34.9|126/127| BL:PDB:REP 195->270|2pliA|1e-12|38.7|75/83| RP:PDB:NREP 2 RP:PDB:REP 20->191|3bp1B|1e-26|7.6|170/250| RP:PDB:REP 198->277|3dedB|1e-14|28.6|77/83| RP:PFM:NREP 1 RP:PFM:REP 200->277|PF03471|3e-11|35.1|77/81|CorC_HlyC| HM:PFM:NREP 3 HM:PFM:REP 201->277|PF03471|5.6e-25|34.2|76/81|CorC_HlyC| HM:PFM:REP 56->113|PF00571|3.1e-11|34.5|55/57|CBS| HM:PFM:REP 134->184|PF00571|5.8e-08|25.5|51/57|CBS| RP:SCP:NREP 2 RP:SCP:REP 49->187|2v8qE1|2e-20|20.6|136/145|d.37.1.1| RP:SCP:REP 195->279|2pliA1|2e-19|35.7|84/84|d.145.1.4| HM:SCP:REP 51->113|1nf7A3|7e-11|33.9|62/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 122->201|1pvmA2|6e-09|25.6|78/78|d.37.1.1|2/2|CBS-domain| OP:NHOMO 2491 OP:NHOMOORG 964 OP:PATTERN ------------------------322333311----------12122---11------------112 2221212433332322222-24--2222222-44443333253342325332534122--334252354432222222112-2222223333-322---223133424112222222222222232211122213122222111222442332221111111-3213233211111111111132311111-344444443444444442-5435445322234333333343222222222222222222231212222222211222221111121111111111111111111111111111111111111111111111-22231112222212123312222-122122-13311-11-------112311333322222233333323333333333333334-223225233332433244444433322323243333222333333332333233422222222222222122222222222222-22222333233333333333333333333233333334224443243343223222533234322222222223332122224323232322222222223333331211111111111131111111-1--122554233222424444434744444553424--3422222-11155444555555555554-4555555555455555555555444445555445444555555555555552-55555555455522322222233332323333333333332233333333344325344444444344443444332323323244434444434444333333322222222253111111222222223421111---1-1-11111---1-----1111111111113 --------211------------------------------------------------------------------------------------------------12-2545564123213-552416F41425131231332-211-11-521326---212--211211111--27121-141-2-412-2-113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 97.1 SQ:SECSTR #######EEEEEEEEEEETcccccHHHHHHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccccGGGGTTcEEEEEEEEEEEEEEEEEcccEEEEEEEEEHHEEEEcHHHHHHHHHTTTTccccHHHHHHHHHHHHHHTcccEEEEEEEEcccTTEEEEEEEEcccccccccccTcccTccccEEEcTTccEEEETcccHHHHHHHHTccccGGcccccHHHHHHHHHcccccTTcEEEETTEEEEEEEETTEcEEEEEEEEEE# PSIPRED ccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEEEHHHEEEEcccccHHHHHHHHHHccccEEEEEEcccccEEEEEEHHHHHHHHHccccccccccccccccHHHHccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHcccccccccccHHHEEEcccEEEEEEEEcHHHHHHHHcccccccccEEEHHHHHHHHHccccccccEEEEccEEEEEEEEcccEEEEEEEEEccc //