[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30671.1
DDBJ      :             PhoH family protein, putative ATPase
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  783/915 : Eukaryota  5/199 : Viruses  7/175   --->[See Alignment]
c.37.1d.194.1
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   115->318 3b85A PDBj 1e-43 57.0 %
:RPS:PDB   19->270 3e1sA PDBj 5e-18 16.4 %
:RPS:SCOP  118->188 1t8hA  d.194.1.2 * 2e-18 14.1 %
:RPS:SCOP  209->323 1w36B1  c.37.1.19 * 3e-10 13.0 %
:HMM:SCOP  24->294 1w36D1 c.37.1.19 * 2e-35 21.3 %
:RPS:PFM   115->316 PF02562 * PhoH 2e-73 60.9 %
:HMM:PFM   115->318 PF02562 * PhoH 9.8e-94 62.7 204/205  
:BLT:SWISS 5->318 PHOL_SHIFL 4e-88 51.9 %
:PROS 277->287|PS00626|RCC1_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30671.1 GT:GENE ACD30671.1 GT:PRODUCT PhoH family protein, putative ATPase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(756655..757638) GB:FROM 756655 GB:TO 757638 GB:DIRECTION - GB:PRODUCT PhoH family protein, putative ATPase GB:PROTEIN_ID ACD30671.1 GB:DB_XREF GI:187712374 LENGTH 327 SQ:AASEQ MNKTQFILEPYNYDAMMLLCGNLDENIRAIENYFDVEIRHRADEFEITSDSSTNNTQAKRFIKSCYAEILAGNTELDLEQITTILNATAKDKAAATAKSRKKVEEAEVQMRSKKLKARTHNQAIYLENIKNNFVTFGVGPAGTGKTYMAIACAVAAYEKGEVRRIVLVRPAVEAGEKLGFLPGDLAQKIDPYLRPMYDALFDFMGVEKVTKLIEKQAIEIAPLAYMRGRTINDSFIVLDESQNTTKEQMKMFLTRIGFNTTAVITGDITQVDLPKNVTSGLSHALSILNDIEGVAISYLKSVDIVRHQIVQKIVNAYDKHEEKTKNG GT:EXON 1|1-327:0| BL:SWS:NREP 1 BL:SWS:REP 5->318|PHOL_SHIFL|4e-88|51.9|312/346| PROS 277->287|PS00626|RCC1_2|PDOC00544| SEG 87->102|atakdkaaataksrkk| BL:PDB:NREP 1 BL:PDB:REP 115->318|3b85A|1e-43|57.0|179/180| RP:PDB:NREP 1 RP:PDB:REP 19->270|3e1sA|5e-18|16.4|220/517| RP:PFM:NREP 1 RP:PFM:REP 115->316|PF02562|2e-73|60.9|202/205|PhoH| HM:PFM:NREP 1 HM:PFM:REP 115->318|PF02562|9.8e-94|62.7|204/205|PhoH| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02562|IPR003714| RP:SCP:NREP 2 RP:SCP:REP 118->188|1t8hA|2e-18|14.1|71/272|d.194.1.2| RP:SCP:REP 209->323|1w36B1|3e-10|13.0|115/469|c.37.1.19| HM:SCP:REP 24->294|1w36D1|2e-35|21.3|207/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1194 OP:NHOMOORG 808 OP:PATTERN 111111-----------111111------------------------------1-------------- 1111221222221122222-22222222222122222222222222222222222223--1122222222211111111-111111112221-2221--1111111211211111111111111111111111111----------231111111222121112111111111112111211211111112122222222222222222222222222122112211111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122--1111111-1-111111111-21111121221221211111211--111222211111111111111111111111111111-22222222111-1111111111111122311111111111111111111111222-----------------------------111111222222222222222222222222222222222-122223222222222222222222111111111222212221222122222-111111121222222112-----------1--------1---22222221222212222222222222222222--12222------22221222222222212-2222222222222222222222222222222112111232222222121121-22222211222211-211111222222222111111-----11111111111111222222222222222222211111111121112222222222222222222222111--12111111--------1-1-------------------------222222222211- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------1-----------1------1-----------1---- -----1-1-----------1---11------------------------------------------1--------------------------------------------------------------------------------------------1-------------- STR:NPRED 286 STR:RPRED 87.5 SQ:SECSTR ##################ccEEHHHHHHHHHHHHcccHHHHHHHHHHHHHH#####TccEEEccccccccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccTTTTTTccHHHHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHTTcHHcEEEEEccHHHHHHHHHHHTccEEEHHHHTEEEEcTTccEEETTHHHHH#HTTcETEETTEEccccccccccEEEccGGGccHHHHHHHHTTccTTcEEEEEEcTTc########cccHHHHHHTTTcTTEEEEEccGGGccccHHHHHHHHHHc######### DISOP:02AL 327-328| PSIPRED ccEEEEEEccccHHHHHHHHcccHHHHHHHHHHcccEEEEcccEEEEEEcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccHHccccccccccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEEccccccccccccEEEEEccccccHHHHHHHHHHcccccEEEEccccHHEEcccccccHHHHHHHHHcccccEEEEEEcccccEEHHHHHHHHHHHHHHHHHHccc //