[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30685.1
DDBJ      :             oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:392 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->340 3gmcA PDBj 2e-13 22.7 %
:RPS:PDB   4->359 3c96A PDBj 1e-23 19.5 %
:RPS:SCOP  3->94 2ivdA1  c.3.1.2 * 1e-07 24.2 %
:RPS:SCOP  114->153 1gv4A2  c.3.1.5 * 5e-05 17.5 %
:RPS:SCOP  146->314 3c96A1  c.3.1.2 * 1e-12 13.1 %
:HMM:SCOP  1->353 1k0iA1 c.3.1.2 * 1.7e-35 26.0 %
:RPS:PFM   2->314 PF01494 * FAD_binding_3 4e-17 27.1 %
:HMM:PFM   9->314 PF01494 * FAD_binding_3 1.7e-14 20.1 293/356  
:HMM:PFM   324->360 PF11588 * DUF3243 0.00085 24.3 37/81  
:BLT:SWISS 3->39 THIO_RHIET 8e-05 43.2 %
:BLT:SWISS 18->366 Y1260_MYCTU 2e-39 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30685.1 GT:GENE ACD30685.1 GT:PRODUCT oxidoreductase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(772090..773268) GB:FROM 772090 GB:TO 773268 GB:DIRECTION - GB:PRODUCT oxidoreductase GB:PROTEIN_ID ACD30685.1 GB:DB_XREF GI:187712388 LENGTH 392 SQ:AASEQ MKKIAINSTGISGLTLAWWLRKYGFEPTLFEKASELRNGDYLVDFWGPACEIMKKMGLFDQLKEKSYQIKNIHCFDENGRRSSKVNISSLITDNYDEFLSVKRGDIAETIYKACQGIDIRFATSIDKIEEKDNHITTHLSDGTKEDFDLVIGADGLHSHIRSLVFDKSEYQEYELDKYVAALSLKNYNHYEKYTYAISVGDKKQVARVCLDENETLVMFIIDLSLVNNFPLTLAEKKQLLVSSFKEFKWETPDILARLTDVDEIYFDKVSQIRMDTWYKGRIALVGDSAACPSVLMGLGSIFAIIEAYILAGELHKAKGNYHIAFEQWQNRLKDIIARKQKVGLSNLSVAASDEIFKKYLSTITVKISSTPVISKFIGAGIFNDPIQIPEYE GT:EXON 1|1-392:0| BL:SWS:NREP 2 BL:SWS:REP 3->39|THIO_RHIET|8e-05|43.2|37/327| BL:SWS:REP 18->366|Y1260_MYCTU|2e-39|31.1|344/372| BL:PDB:NREP 1 BL:PDB:REP 2->340|3gmcA|2e-13|22.7|322/369| RP:PDB:NREP 1 RP:PDB:REP 4->359|3c96A|1e-23|19.5|349/381| RP:PFM:NREP 1 RP:PFM:REP 2->314|PF01494|4e-17|27.1|299/338|FAD_binding_3| HM:PFM:NREP 2 HM:PFM:REP 9->314|PF01494|1.7e-14|20.1|293/356|FAD_binding_3| HM:PFM:REP 324->360|PF11588|0.00085|24.3|37/81|DUF3243| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| RP:SCP:NREP 3 RP:SCP:REP 3->94|2ivdA1|1e-07|24.2|91/341|c.3.1.2| RP:SCP:REP 114->153|1gv4A2|5e-05|17.5|40/133|c.3.1.5| RP:SCP:REP 146->314|3c96A1|1e-12|13.1|153/269|c.3.1.2| HM:SCP:REP 1->353|1k0iA1|1.7e-35|26.0|242/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 270 OP:NHOMOORG 158 OP:PATTERN -------------------------------------------------------------------- ----3--1------32233-31--6422222412222-11-1--111--21------1--11--413-71---------------------------------1-2--------------------------------------1------------------------------------------------1------11--1----1---111---------------------------------1111---------------------------------------------------------------------------------------------------------------------------1---------1111----------11-11111---1-11--11---1--1----1-11-11----1-------------------------------------------------------1--1--1-11111-1----------------------------------------------------------------------------------------3-------------------------------------1--------------------1-------------------1------------------------------111---------------------2-------1------------------------------1---------------1111112-------------------1112131-11-1-----------------2-1-------------------------------------------------------------------- ---------------2241122-3333------111----------2223365722322-----1------------------------3--2---1-1--51------1---------------------------------------------------------------------8111-----131-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 359 STR:RPRED 91.6 SQ:SECSTR EccEEEEcccHHHHHHHHHHHTTccEEEEEEccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEcGGGGTcccHcEEEEEHHHHHHHHHHHHHTTcEEEcEEEEEEEEETTEEEEEEEETTccEEcEEEEcccTTcHHHHHHcTTccccEEEEEEEEEEEETTccEEEEEEcTTccEEEEEEccHHHHTTTcEEEEEEEEEEHHHHccTTccccHHHHHHHHTTcccTTccHHHHHHTccEEEEEEEEEccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH################################# PSIPRED ccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccEEEcHHHHHHHHHcccHHHHHHccccccEEEEEcccccEEEEEcccHHcccccccEEEEEHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEccccEEEEEEEEEccccccHHHHHcccccccccccEEEEEEEEEccccccccccEEEEEEccccEEEEEEcccccEEEEEEEccccccccccccHHHHHHHHHHHHHccHHHHHHHHHccccccEEEcHHHHccccHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccc //