[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30696.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30696.1 GT:GENE ACD30696.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 785726..786055 GB:FROM 785726 GB:TO 786055 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30696.1 GB:DB_XREF GI:187712399 LENGTH 109 SQ:AASEQ MYNDLTRELLRQVKFEDGIILAEQTKYSVSDSFSTVEIYICDKRVSYRVYGDAYILAMLKWLQLSLLNKQNLSQISLEKLIADFDLPQVKYRDALQIIKLIEKINAAAI GT:EXON 1|1-109:0| SEG 59->77|lkwlqlsllnkqnlsqisl| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHccccccEEEEEEcEEEEcccEEEEEEEEEccccEEEEEcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccc //