[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30698.1
DDBJ      :             DedA family protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  514/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   75->171 PF09335 * SNARE_assoc 1e-09 38.9 %
:HMM:PFM   49->171 PF09335 * SNARE_assoc 7.7e-23 30.2 116/123  
:HMM:PFM   14->25 PF03791 * KNOX2 0.00092 50.0 12/52  
:BLT:SWISS 1->182 DEDA_ECOLI 3e-47 46.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30698.1 GT:GENE ACD30698.1 GT:PRODUCT DedA family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(786813..787460) GB:FROM 786813 GB:TO 787460 GB:DIRECTION - GB:PRODUCT DedA family protein GB:PROTEIN_ID ACD30698.1 GB:DB_XREF GI:187712401 LENGTH 215 SQ:AASEQ MDTISALLNIVLHLDQFISTYINILGDWTYLLLFLVIFCETGLVITPFLPGDSLLFAIGLTGAATTLNVHLVAPILVAAAVCGDSCNYFLGRMIGKRIFKDNAKILKTAHLLKAQEFFNKYGPAAIILARFTPLVRTFMPFTAGMARMRYTKFVAMGIIGAFIWVYSIVYLAFFFSNNAFVKKYFGLFIILIVVVSLIPPTISFIKAFKNKLLDR GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 1->182|DEDA_ECOLI|3e-47|46.2|182/219| TM:NTM 5 TM:REGION 2->24| TM:REGION 33->55| TM:REGION 69->91| TM:REGION 153->175| TM:REGION 185->207| SEG 189->203|iilivvvslipptis| RP:PFM:NREP 1 RP:PFM:REP 75->171|PF09335|1e-09|38.9|95/119|SNARE_assoc| HM:PFM:NREP 2 HM:PFM:REP 49->171|PF09335|7.7e-23|30.2|116/123|SNARE_assoc| HM:PFM:REP 14->25|PF03791|0.00092|50.0|12/52|KNOX2| OP:NHOMO 810 OP:NHOMOORG 532 OP:PATTERN --------------------------------------1-1--21--1--------------11---1 111-211-22222121111-1111111111111111224313112----1111241-1221132322331--111111111111-11111211111---2-11--122-2--------------111122112211---------11-11112--11-------1-2-12-1---1-1----1111----11-1-----1------11---11-1-----11---3333331121111111111111131112-2122212111222211113222111111-----11---------------------------------11--12-----111-11111-3441-------11111-----1-1-11---11-1-----------1-1---1--1------------11-11-11----------------1------1-------111111111--1---------------------------------------211121111111111111321111121121211111111111211111122111112222222221111111-------12-1111-1--112--1112-11-1--11-1-1---1-------1-1-111222-------1-1--1---1111-2--1--1----1-------23333232222222222-2223222222222222222222332233333333333333333322222223-222222222222112-2222222222-1--111111-11111111222222311---1111111111111-222333333333----1-----11-11--1-1-------------112222----------------------------------------------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------111D11111-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 215-216| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //