[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30725.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:PSIPRED
:HMM:PFM   1->20 PF12393 * Dr_adhesin 0.00024 55.0 20/21  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30725.1 GT:GENE ACD30725.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(817703..817831) GB:FROM 817703 GB:TO 817831 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30725.1 GB:DB_XREF GI:187712428 LENGTH 42 SQ:AASEQ MKKLTIAATFIISIISTSFAALAHQINSRNSTSFPTQEFILA GT:EXON 1|1-42:0| TM:NTM 1 TM:REGION 5->27| SEG 4->23|ltiaatfiisiistsfaala| HM:PFM:NREP 1 HM:PFM:REP 1->20|PF12393|0.00024|55.0|20/21|Dr_adhesin| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcc //