[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30727.1
DDBJ      :             heat shock protein 15
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  288/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:122 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->104 1dm9B PDBj 2e-30 57.7 %
:RPS:PDB   1->104 1dm9B PDBj 3e-28 57.7 %
:RPS:SCOP  1->89 1dm9A  d.66.1.3 * 2e-09 61.8 %
:HMM:SCOP  3->99 1dm9A_ d.66.1.3 * 2.4e-21 36.1 %
:HMM:PFM   3->48 PF01479 * S4 3.4e-11 37.0 46/48  
:HMM:PFM   52->93 PF07926 * TPR_MLP1_2 0.00057 21.4 42/132  
:BLT:SWISS 1->104 HSLR_ECOLI 5e-30 57.7 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30727.1 GT:GENE ACD30727.1 GT:PRODUCT heat shock protein 15 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(819527..819895) GB:FROM 819527 GB:TO 819895 GB:DIRECTION - GB:PRODUCT heat shock protein 15 GB:PROTEIN_ID ACD30727.1 GB:DB_XREF GI:187712430 LENGTH 122 SQ:AASEQ MSVRLDKWLWATRFYKTRALAKKAIEGGKVHFQGQKTKVSKIVNIGDTYQIQQDYIKKTVIVEALDEVRKSASEAQKLYRETAESIEKREQETILRKTANLISPEKPTKKQRSQIIDFKRNG GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 1->104|HSLR_ECOLI|5e-30|57.7|104/133| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 61->92| BL:PDB:NREP 1 BL:PDB:REP 1->104|1dm9B|2e-30|57.7|104/107| RP:PDB:NREP 1 RP:PDB:REP 1->104|1dm9B|3e-28|57.7|104/107| HM:PFM:NREP 2 HM:PFM:REP 3->48|PF01479|3.4e-11|37.0|46/48|S4| HM:PFM:REP 52->93|PF07926|0.00057|21.4|42/132|TPR_MLP1_2| RP:SCP:NREP 1 RP:SCP:REP 1->89|1dm9A|2e-09|61.8|89/104|d.66.1.3| HM:SCP:REP 3->99|1dm9A_|2.4e-21|36.1|97/104|d.66.1.3|1/1|Alpha-L RNA-binding motif| OP:NHOMO 289 OP:NHOMOORG 288 OP:PATTERN -------------------------------------------------------------------- 111-1---------------------------------------------------1-------------------------------1111-111---------1---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1--111------------------------1-----111---------------------------------------------------111-11111111111111111111111111111--111111111111--111111111112111111--11----1------------------------------------------------------111111111111111111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------11111111111111111111111111111111111111111111111111111111111111111111111111111111111------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 85.2 SQ:SECSTR ccccHHHHHHHTTccccHHHHHHHHHTTcEEETTEEccTTccccTTcEEEEEETTEEEEEEEcccccccccTTGGGGGEEEcHHHHHHHHHHHHHHHHHHHHcc################## PSIPRED cccEEEEEEEHHHccccHHHHHHHHHcccEEEccEEcccccccccccEEEEEcccEEEEEEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHccc //