[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30729.1
DDBJ      :             auxiliary transport protein, membrane fusion protein (MFP) family, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  342/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.46.1
:281 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   47->205 3fppB PDBj 7e-11 28.9 %
:RPS:PDB   146->216 2ejmA PDBj 6e-11 16.2 %
:RPS:SCOP  38->280 1t5eA  f.46.1.1 * 2e-18 20.1 %
:HMM:SCOP  31->200 1vf7A_ f.46.1.1 * 1.1e-15 31.4 %
:RPS:PFM   144->207 PF00529 * HlyD 2e-07 32.8 %
:HMM:PFM   51->160 PF00529 * HlyD 1.1e-13 29.1 110/306  
:HMM:PFM   130->270 PF00529 * HlyD 4.1e-12 25.2 139/306  
:BLT:SWISS 28->280 YDHJ_ECOLI 5e-46 39.7 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30729.1 GT:GENE ACD30729.1 GT:PRODUCT auxiliary transport protein, membrane fusion protein (MFP) family, putative GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(828252..829097) GB:FROM 828252 GB:TO 829097 GB:DIRECTION - GB:PRODUCT auxiliary transport protein, membrane fusion protein (MFP) family, putative GB:PROTEIN_ID ACD30729.1 GB:DB_XREF GI:187712432 LENGTH 281 SQ:AASEQ MSNKNTKSIISIIIILFALFSLYAMWQYYLYSPWTRDGRIRAKIITIAPDVSNMYVSDNQKVKKGQLIFTIDDQRYAATLEGKEAELKHAMIEWQLAEKQYLRRIRLGRDDSISREELDDYAMQEKLRKADLEKAKAEAELAKINLDRTKIYAPADGTINNIDLRQGNYVVSSKPVMSLVKAGSFYVTGYFEETKLPHIKIGDKAKIILMSGGEPLYGHVISIGKAVADNNTDVNNQLLPKVQETYDWVRLSKRIPVDIALDKVPINTELVSGMNATVTIK GT:EXON 1|1-281:0| BL:SWS:NREP 1 BL:SWS:REP 28->280|YDHJ_ECOLI|5e-46|39.7|252/285| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 122->151| TM:NTM 1 TM:REGION 7->29| SEG 8->15|siisiiii| SEG 125->143|eklrkadlekakaeaelak| BL:PDB:NREP 1 BL:PDB:REP 47->205|3fppB|7e-11|28.9|159/267| RP:PDB:NREP 1 RP:PDB:REP 146->216|2ejmA|6e-11|16.2|68/99| RP:PFM:NREP 1 RP:PFM:REP 144->207|PF00529|2e-07|32.8|64/259|HlyD| HM:PFM:NREP 2 HM:PFM:REP 51->160|PF00529|1.1e-13|29.1|110/306|HlyD| HM:PFM:REP 130->270|PF00529|4.1e-12|25.2|139/306|HlyD| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 1 RP:SCP:REP 38->280|1t5eA|2e-18|20.1|219/231|f.46.1.1| HM:SCP:REP 31->200|1vf7A_|1.1e-15|31.4|156/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 862 OP:NHOMOORG 345 OP:PATTERN -------------------------------------------------------------------- 111------------------------------------------------------------------------------------------1-----1--1--2---1--------------111-11--1----------------------------------------------------------1---------------------------------------1--11111111111111--------------------------------------------------------------------------------------------------------------------1---------2-211-11111335312-131---13221321222-1221132312--31122314442122------1-11---44444444-4441-12------------1111111111111------2321211-34566642111144421111128432425----------1---2--1--111111111111------------1-----------1-221-11-1-----------1----------------1--31-------1--2333-1144412-1211--------------54223535556567566-565666766656655555458522112343333333333333335354446--533333333333----11111434412122----1----------1111112--12-44544343155642333223212212-1224------32233322222111------------------------------------------------------------2-- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 60.9 SQ:SECSTR ############################################EEccEEccEEcccTTccccTTcEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccTTEEEccccEEEEEEccccEEEEEccccEEEEEEcccTTEEEcT#cTTccc################################################################# PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEccEEEEEEEccccEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccEEEccccEEEEEEEEccccEEccccEEEEEEEcccEEEEEEEcHHHHHHcccccEEEEEEcccccEEEEEEEEEEcccccccccEEEEEEccccccccEEEEEEEEEEEEEEEccccccccccccEEEEEEc //