[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30730.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->31 PF07869 * DUF1656 2.4e-06 40.7 27/58  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30730.1 GT:GENE ACD30730.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(829099..829302) GB:FROM 829099 GB:TO 829302 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30730.1 GB:DB_XREF GI:187712433 LENGTH 67 SQ:AASEQ MPILTFDGLLFSPLLLFVAIALILTILTNLIAPELLKSKKYTNLKLSWLNLAIFLCYLGLVMFILGD GT:EXON 1|1-67:0| TM:NTM 2 TM:REGION 9->31| TM:REGION 44->66| SEG 14->32|lllfvaialiltiltnlia| HM:PFM:NREP 1 HM:PFM:REP 5->31|PF07869|2.4e-06|40.7|27/58|DUF1656| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25| PSIPRED cccEEEHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcc //