[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30732.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->29 PF07011 * DUF1313 0.0004 44.4 18/89  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30732.1 GT:GENE ACD30732.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(831312..831428) GB:FROM 831312 GB:TO 831428 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACD30732.1 GB:DB_XREF GI:187712435 LENGTH 38 SQ:AASEQ MISANSLIWHQIVNFLNENISKIVQIHSKAISITNIDL GT:EXON 1|1-38:0| HM:PFM:NREP 1 HM:PFM:REP 12->29|PF07011|0.0004|44.4|18/89|DUF1313| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccc //