[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30741.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->89 PF07007 * DUF1311 6.1e-05 30.6 36/95  
:HMM:PFM   22->64 PF06656 * Tenui_PVC2 0.00026 18.6 43/785  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30741.1 GT:GENE ACD30741.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(839922..840215) GB:FROM 839922 GB:TO 840215 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30741.1 GB:DB_XREF GI:187712444 LENGTH 97 SQ:AASEQ MKKLIIMTLTILPTLVAADKVCDGNTYEINACLKSQMQIYDTKLNDVQNHDIKNFKKYRDNICYDISSTYKGGTYQAIKYGNCVISLDKWYLQQLKP GT:EXON 1|1-97:0| SEG 4->15|liimtltilptl| HM:PFM:NREP 2 HM:PFM:REP 54->89|PF07007|6.1e-05|30.6|36/95|DUF1311| HM:PFM:REP 22->64|PF06656|0.00026|18.6|43/785|Tenui_PVC2| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25| PSIPRED ccEEEEEHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHHHccccccccHHHHHHHHcccEEEEccccccccEEEEEEccEEEEEHHHHHHHccc //