[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30749.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:360 amino acids
:PSIPRED
:HMM:PFM   123->173 PF02453 * Reticulon 5.6e-05 19.6 51/164  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30749.1 GT:GENE ACD30749.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 851676..852758 GB:FROM 851676 GB:TO 852758 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30749.1 GB:DB_XREF GI:187712452 LENGTH 360 SQ:AASEQ MLSLSEVYSKYLDQDPMRIFQDGAVKSAIILFSFLAITSFFHIDKNLIIMSILFIANLSGSILLGSIQAKRIAFVMYLISAIVVINLSPYVHNIFENDFILIVFVVFIAFWVRRFGEAFTTFPIMVVVLTCICFIRFPLAQYNHLSFTFTAILIGLAFYILIIRNYKIMKSGDIEKIVHEFMRLYIRNYLNAFDKAKSRKFTQTDIVSVSNLKYQNINSLKNHGLMFLRKSTQDSWRYFTHNFVVFNRLTSRFILSYKRLISNYMLLGFEDNYEVKTLSQDLERVFKETLFLMLYVQKKPDLFKKKSDEIENLKYRLEISYIQKYQHDKQKRKLLFDCILLLDDMFISLVNIKEAYYDLF GT:EXON 1|1-360:0| TM:NTM 5 TM:REGION 19->41| TM:REGION 46->68| TM:REGION 83->105| TM:REGION 118->140| TM:REGION 146->168| SEG 99->108|filivfvvfi| HM:PFM:NREP 1 HM:PFM:REP 123->173|PF02453|5.6e-05|19.6|51/164|Reticulon| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //