[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30750.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:301 amino acids
:PSIPRED
:HMM:PFM   235->293 PF05003 * DUF668 1e-05 20.8 53/88  
:HMM:PFM   73->164 PF07226 * DUF1422 0.00014 24.1 87/118  
:HMM:PFM   2->117 PF00892 * EamA 3e-05 14.8 115/126  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30750.1 GT:GENE ACD30750.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 852745..853650 GB:FROM 852745 GB:TO 853650 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30750.1 GB:DB_XREF GI:187712453 LENGTH 301 SQ:AASEQ MIFFRDRAIDKISDTTLLAYRVLIASALGLVICYAMFSYSGDSDFRDRIYWVVIAVVSVAASTSTSVVYTRAKAIIIFSLLGTSTGSIILILIQKSVPDSFTIVAIFCVIALTLYIYTLFLNYATSVFFIHIYLVMFFGLFIGWDKELFLVRVTCVAIGTICIVLITFLTRGQKYRILFNKEMYSLYGELKKLVDDVDKSVKNRKLISLIEQAIKLNETLVNAKYEFPTTKKYYEYKKIIVLIDELLINLKTYRTLFIQQKKHKDDLYKELVDHTKQQVRRNFKKITIRYDKILYQYYYSK GT:EXON 1|1-301:0| TM:NTM 6 TM:REGION 17->39| TM:REGION 48->70| TM:REGION 73->95| TM:REGION 97->119| TM:REGION 122->144| TM:REGION 149->171| SEG 52->68|vviavvsvaaststsvv| SEG 190->202|lkklvddvdksvk| SEG 224->238|kyefpttkkyyeykk| HM:PFM:NREP 3 HM:PFM:REP 235->293|PF05003|1e-05|20.8|53/88|DUF668| HM:PFM:REP 73->164|PF07226|0.00014|24.1|87/118|DUF1422| HM:PFM:REP 2->117|PF00892|3e-05|14.8|115/126|EamA| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHcc //