[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30752.1
DDBJ      :             oxidoreductase, short-chain dehydrogenase family protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  854/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:240 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   50->238 2japC PDBj 1e-30 36.4 %
:RPS:PDB   6->223 1a27A PDBj 1e-31 20.8 %
:RPS:SCOP  7->221 1pwxA  c.2.1.2 * 1e-33 17.2 %
:HMM:SCOP  1->237 1zemA1 c.2.1.2 * 5.2e-60 30.5 %
:RPS:PFM   24->163 PF00106 * adh_short 2e-15 31.4 %
:HMM:PFM   6->164 PF00106 * adh_short 1.5e-33 29.2 154/167  
:BLT:SWISS 5->238 Y1627_STAS1 2e-34 35.1 %
:PROS 133->161|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30752.1 GT:GENE ACD30752.1 GT:PRODUCT oxidoreductase, short-chain dehydrogenase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 854676..855398 GB:FROM 854676 GB:TO 855398 GB:DIRECTION + GB:PRODUCT oxidoreductase, short-chain dehydrogenase family protein GB:PROTEIN_ID ACD30752.1 GB:DB_XREF GI:187712455 LENGTH 240 SQ:AASEQ MAKSLVVITGASSGIGAAIAKRFSEAGHSLLLVGRRVEKIEELNLPNTLIRKVDVTDAHALKNAIKEAEAQYGPVDCLVNNAGLMLLGQIDTQDPIEWQKMYDVNVLVLLNGMQAVLADMRSRKTGTIINISSIAGKKSFANHAAYVGTKFAVSSISKNVREEVANDNVRIMTICPGAVETELLSHTTSEKIKEDYQSWKESMGGVLAADDIARTAMFMYSQPQNINIREVVIATTKQPA GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 5->238|Y1627_STAS1|2e-34|35.1|231/246| PROS 133->161|PS00061|ADH_SHORT|PDOC00060| SEG 10->20|gassgigaaia| BL:PDB:NREP 1 BL:PDB:REP 50->238|2japC|1e-30|36.4|187/246| RP:PDB:NREP 1 RP:PDB:REP 6->223|1a27A|1e-31|20.8|216/285| RP:PFM:NREP 1 RP:PFM:REP 24->163|PF00106|2e-15|31.4|140/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 6->164|PF00106|1.5e-33|29.2|154/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 7->221|1pwxA|1e-33|17.2|215/252|c.2.1.2| HM:SCP:REP 1->237|1zemA1|5.2e-60|30.5|236/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 10044 OP:NHOMOORG 1087 OP:PATTERN ----122654545442-4-----192253557-1---------21133--522-12----22432-45 DEL1P312339765ZodHH-Hd55OzHHHHHLgnnoKhyp4L7YFA931A71DC841711CDI3DAOJOH9-222---2254I112--4565-2221--86P4CBr8Q6B11111111111111375488644767ABBBB221F7FBGD8776633332554154AHBP9223211122231B575565196EDDDDDECDDCCCDGBF8FF9FCBD9DDHHE8766675CQ444444334444443A776972B18B161219D557866458A9676564656454444444444445655676666666444332444633568333343434473551475431115631133112125233343444A2AQAAB11111J8nWW645LGMHFDEEDCCEDEEL-IIIIDXFPLYG1iPPJdTXoiheYIS9BAEENGBEGGDH66666666GGH76A95--111111-1--1122-11--1--1111199VV67BJGDObVWceWKGGHESSgdIHII9JjNpEgTL48CDEE8C77GCPDVP7C82345752222222127F945G495112--222224753933456AA6JO1313212222222223233333323134464699CA6KB5455674A97666667776A--2224511----8CFE5A76777667666-7567867787756776777CIE967696466666666645467H55554453-6777877778971-1433333AA9A18FFG333626222122133IIHFJAC598G4FGCE8EJHHABGFDIEG5343343332222A44444764678ACADAA66664541233998788--------1-3----2-1-2-1------2-------3431143464381 1111ZRB-2-1-486FJGFMEHGVHSNAB55557A86A79689664HCGSKMYSHJC9988943343213425433322437764685-EMAJ6N95554346EC6-998vMJFDJ972628F5FC2H7FgC-ECG8744B6ALB38813A33F9GFGKbfPAYOGHJHRO7APM565271215DADDWBC868H69A8 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 99.2 SQ:SECSTR cccEEEEEcccccHHHHHHHHHHHTcTTccEEEEEEEccGGGTcTTcEEEEEccTTcHHHHHHHHHHHTcTTccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTcEEEEEEEEGGGTcccTTcHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEccccccTTTTccccHHHHHHHccHHHHHHcccHHHHHHHHHHHHHcccTEccccHHHHccTc## PSIPRED ccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccc //