[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30763.1
DDBJ      :             oligoketide cyclase/lipid transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  383/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->142 1t17A PDBj 4e-13 28.6 %
:RPS:PDB   3->143 2d4rA PDBj 6e-23 15.0 %
:RPS:SCOP  1->142 1t17A  d.129.3.6 * 9e-41 27.7 %
:HMM:SCOP  1->144 1t17A_ d.129.3.6 * 2.2e-31 29.4 %
:RPS:PFM   14->134 PF03364 * Polyketide_cyc 4e-23 39.7 %
:HMM:PFM   10->134 PF03364 * Polyketide_cyc 1.5e-30 34.4 125/130  
:BLT:SWISS 1->142 YFJG_SHIFL 1e-34 43.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30763.1 GT:GENE ACD30763.1 GT:PRODUCT oligoketide cyclase/lipid transport protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 873094..873525 GB:FROM 873094 GB:TO 873525 GB:DIRECTION + GB:PRODUCT oligoketide cyclase/lipid transport protein GB:PROTEIN_ID ACD30763.1 GB:DB_XREF GI:187712466 LENGTH 143 SQ:AASEQ MNKVNKSAVVNYSAAQMYELVNDIRSYPKFLPMCYDIEIFEQTETETKASLKIKSGFVKLDFGTHNTMVKNEHIHLNLMNGPFKSLTGDWKFEPIDEDSCKVSLDMEFTFENKFVEMALGPVFRGLADKMLGAFCKRAEEVYK GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 1->142|YFJG_SHIFL|1e-34|43.0|142/158| BL:PDB:NREP 1 BL:PDB:REP 9->142|1t17A|4e-13|28.6|133/148| RP:PDB:NREP 1 RP:PDB:REP 3->143|2d4rA|6e-23|15.0|140/144| RP:PFM:NREP 1 RP:PFM:REP 14->134|PF03364|4e-23|39.7|121/128|Polyketide_cyc| HM:PFM:NREP 1 HM:PFM:REP 10->134|PF03364|1.5e-30|34.4|125/130|Polyketide_cyc| RP:SCP:NREP 1 RP:SCP:REP 1->142|1t17A|9e-41|27.7|141/148|d.129.3.6| HM:SCP:REP 1->144|1t17A_|2.2e-31|29.4|143/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 389 OP:NHOMOORG 387 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-1111111111111111-11-1111111111111111111111-1-111111111111111111111111111--1-------1111111111111111-11111111111111111111111111111-1111111111111111111111111111111111111111111111111---------------------------------------------------------11111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111-11111111111111111111111111111-111111-1-1----1111----------111111111111111111121111111111111111111111111111111111111111-------------------------------------------------------- ----------------------------------------------------------------------------------------------1--------------------------------------------------------------1-----2---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEEEcccHHHHHHHHHcHHHHGGGcTTEEEEEEEEEETTEEEEEEEEEETEEEEEEEEEEEETTTTEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEcccTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 143-144| PSIPRED ccEEEEEEEEcccHHHHHHHHHcHHHcHHHcccccEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEcccEEEEEEEccccHHEEEEEEEEEcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //